Identifiers and Description

Gene Model Identifier

TTHERM_00201700

Standard Name

RAB50

Aliases

PreTt13741 | 17.m00348

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00157 ) ribosome small subunit-dependent GTPase A
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00201700

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41344.19.997975313387782e-28hypothetical protein (168 aa)
OxytrichaContig6560.0.g894.999245259173412e-21Ras family
WormBaseWBGene000042761.000116773704384e-19locus:rab-14 status:Confirme
d UniProt:Q93874 protein_i
d:CAB01884.1
DictyBaseDDB_G02813374.998394530072393e-19rab14 on chromosome: 3 positio
n 4383385 to 4384571
SGDYFL005W4.997543945741262e-17SEC4 Rab family GTPase essenti
al for vesicle-mediated exocyt
ic secretion and autophagy; as
sociates with the exocyst comp
onent Sec15p and may regulate
polarized delivery of transpor
t vesicles to the exocyst at t
he plasma membrane

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00201700(coding)
ATGTTTGCTAAAAAAGGCAGTTAATAAAAAAGTATAATATGTATTTCTGTAGGAGATGCA
AATGTTGGAAAATCTTCTATATTTGCAAGGCAATTTTATGGAGAGGTTCCTCAATAAAAT
TCCCTCTATGTTGATTATTCAACCATATTGGTGAGAAAAGGAAATGAAGAGATTTAATTT
AAATTTTGGGTCATAAATCACCTTCACAAACATTTAACATCATAATATTATAGAACTTCT
ATTTTAATTATGATTTACGATATTACAAGCAGAGACTCATTTACACATATTTAATATTAT
TATGAAGATTATGTTAAAAAATGTAATATAAAATCAATAATTGCTCTTGTTGGAAATAAG
AAGGATCTAAATGAGTTTAGATAAGTTTCATTTTAGGAGGGTTAAGATCTAGCCAAATCA
TTAGGTGTAGATTTTTTTGAAGTATCTGCTTTTACAGGTGATAAAGTAAAAGATTTGTAT
GACTTTTTAATAAACTAGTCTTTTGATACAGCTAATTTTGAATGA


>TTHERM_00201700(protein)
MFAKKGSQQKSIICISVGDANVGKSSIFARQFYGEVPQQNSLYVDYSTILVRKGNEEIQF
KFWVINHLHKHLTSQYYRTSILIMIYDITSRDSFTHIQYYYEDYVKKCNIKSIIALVGNK
KDLNEFRQVSFQEGQDLAKSLGVDFFEVSAFTGDKVKDLYDFLINQSFDTANFE


>TTHERM_00201700(gene)
ATGTTTGCTAAAAAAGGCAGTTAATAAAAAAGTATAATATGTATTTCTGTAGGAGATGCA
AATGTTGGAAAATCTTCTATATTTGCAAGGCAATTTTATGGAGAGGTTCCTCAATAAAAT
TCCCTCTATGTTGATTATTCAACCATATTGGTGAGAAAAGTAAAATACATATTTCAAATT
TAGTTTTTTTAGTAGATTTTAAACATTTTAGGGAAATGAAGAGATTTAATTTAAATTTTG
GGTCATAAATCACCTTCACAAACATTTAACATCATAATATTATAGAACTTCTATTTTAAT
TATGATTTACGATATTACAAGCAGAGACTCATTTACACATATTTAATATTATTATGAAGA
TTATGTTAAAAAATGTAATATAAAATCAATAATTGCTCTTGTTGGAAATAAGAAGGATCT
AAATGAGTTTAGATAAGTTTCATTTTAGGAGGGTTAAGATCTAGCCAAATCATTAGGTGT
AGATTTTTTTGAAGTATCTGCTTTTACAGGTGATAAAGTAAAAGATTTGTATGACTTTTT
AATAAACTAGTCTTTTGATACAGCTAATTTTGAATGA