Identifiers and Description

Gene Model Identifier

TTHERM_01097960

Standard Name

RAB4B

Aliases

PreTt26961 | 231.m00045 | 3816.m00165

Description

Rab II family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_01097960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20828.11.9996807727516527e-135Ras family protein (213 aa)
DictyBaseDDB_G02924061.0004460510701209e-64rab4 on chromosome: 6 position
1558648 to 1559514
OxytrichaContig22591.0.g1121.0002758036576784e-62Ras family
WormBaseWBGene000042766.9972728945133496e-59locus:rab-14 status:Confirme
d UniProt:Q93874 protein_i
d:CAB01884.1
SGDYGL210W3.0006824396935516e-51YPT32 Rab family GTPase, very
similar to Ypt31p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi
Stentor CoeruleusSteCoe_289452.9374821117108028e-30

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01097960(coding)
ATGGATAAGGAAAAGTCATATGATCTATTATATAAATTTATAATTATTGGCAATACAAGC
ACTGGCAAAACATGCACTTTACACAATTTTCTTGAGGGAAAATTTAAAAAAAACTCTTCT
TACACAATTGGCGTTGAGTTTGGCTCAAAAGTAGTGACTGCAAAAAATAAAAACATTAAA
TTATAAATTTGGGATACAGCTGGTTAAGAGAGATTTAAATCAGTAGCAAGAACTTATTAT
AGAGGAGGATTAGGTGCTATAATCGTTTATGACATTACAGATGTAGAATCATTTCACTCT
GTAAAATAATGGATAGCAGATGCAAGAGAATTAGCTAGAAGTGACATTTGTATAGCAGTT
TGTGGAAATAAATGCGATTTGAAAGAAGAAAGACAAGTTTCTTAACAAGATGCTGAAAAC
TTCTGTAAAGAAAATAATGTGATGTTTTTTGAAATATCTGCCTTAACTGGTGAAAATGTT
GAGAATGCCTTTTTAGAAGTCACTAAAGTTATCACTGAAATGGTTGAAAAAGGTTAAATT
AGTATGTCTGATTTAAAGCCAAGAATTACTGCAGGTTTAGGAGAACACACTAGAAAGCCA
GACTTATAAGAATAAAATTAAAATATGTGTTCTTGCTGA


>TTHERM_01097960(protein)
MDKEKSYDLLYKFIIIGNTSTGKTCTLHNFLEGKFKKNSSYTIGVEFGSKVVTAKNKNIK
LQIWDTAGQERFKSVARTYYRGGLGAIIVYDITDVESFHSVKQWIADARELARSDICIAV
CGNKCDLKEERQVSQQDAENFCKENNVMFFEISALTGENVENAFLEVTKVITEMVEKGQI
SMSDLKPRITAGLGEHTRKPDLQEQNQNMCSC


>TTHERM_01097960(gene)
ATGGATAAGGAAAAGTCATATGATCTATTATATAAATTTATAATTATTGGCAATACAAGC
ACTGGCAAAACATGCACTTTACACAATTTTCTTGAGGGAAAATGTAATATTATATTTTTT
TAATATATTGCATAAAGTATGACAGTTTAATTCTTACAAATATCATGCTTTGTGAGATTA
AAAATACAAAATTTATTTTAAATCAATGATAACTAAATTATTCTTATATTAAAATAGTTA
AAAAAAACTCTTCTTACACAATTGGCGTTGAGTTTGGCTCAAAAGTAGTGACTGCAAAAA
ATAAAAACATTAAATTATAAATTTGGGATACAGCTGGTTAAGAGAGATTTAAATCAGTAG
CAAGAACTTATTATAGAGGAGGATTAGGTGCTATAATCGTTTATGACATTACAGAGTAGA
TATTTTATTTTTAGATATTTTTGTTTAAACTAAAATTAATTTTAGTGTAGAATCATTTCA
CTCTGTAAAATAATGGATAGCAGATGCAAGAGAATTAGCTAGAAGTGACATTTGTATAGC
AGTTTGTGGAAATAAATGCGATTTGAAAGAAGAAAGACAAGTTTCTTAACAAGATGCTGA
AAACTTCTGTAAAGAAAATAATGTGATGTTTTTTGAAATATCTGCCTTAACTGGTGAAAA
TGTTGAGAATGCCTTTTTAGAAGTCACTAAAGTTATCACTGAAATGGTTGAAAAAGGTAA
AAAATTAACTTAATTTGAATAAATCATAAAAATTGATAATTTTTTTTACAAAAAGGTTAA
ATTAGTATGTCTGATTTAAAGCCAAGAATTACTGCAGGTTTAGGAGAACACACTAGAAAG
CCAGACTTATAAGAATAAAATTAAAATATGTGTTCTTGCTGA