Identifiers and Description

Gene Model Identifier

TTHERM_00001080

Standard Name

RAB4A

Aliases

PreTt11517 | 1.m00565

Description

Rab II family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00001080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19228.14.0008150871967356e-141Ras-like protein Rab-4A (214 a
a)
OxytrichaContig13582.0.g554.0018838296491823e-56Ras family
DictyBaseDDB_G02924066.998985483803218e-56rab4 on chromosome: 6 position
1558648 to 1559514
WormBaseWBGene000042761.0004249259458435e-52locus:rab-14 status:Confirme
d UniProt:Q93874 protein_i
d:CAB01884.1
SGDYER031C6.997125142158947e-47YPT31 Rab family GTPase, very
similar to Ypt32p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi
Stentor CoeruleusSteCoe_289451.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00001080(coding)
ATGTAGGATTTTTACCCTAAAAAGAAGGAAGAATAGGTTGACACTCTTTTTAAATTCATA
ATAGTAGGAAATGCTTCATCAGGAAAGACATGCTTGTTACATTATTTTATAGAAGGAAAG
CCAAAATAAAATTCAACTTATACTATTGGTGTTGAATTTGGGTCTAAAATTGAAAAGGTT
GGATCAAAGCTAGTTAAATTTTAAATTTGGGATACTGCAGGATAGGAAAGATTTAGATCA
GTAGCACGCACATATTATAGGGGAGCAGTAGGAGCAGTAATCGTTTTTGATCTGACAAAC
ATAGATTCATTTCACTCACTTTAAAATTGGGTCAATGATGTTAGAGAATTAGCAAATAAG
GAAGTATGTATTGTAGTTTGTGGAAATAAATCTGATTTGACAGATGAACGTGCAGTTTAA
AGTCATGAAGCAAAACGTTAATGTGAAAGTCTAGATGTAGAATACATCGAAACAAGCGCA
TTAACTGGTGAAAATGTAAATGAAGCATTTTCTATTATAACTAAGACTATTTTGCAAAAA
ATAGAAAATAATTAAATGGAGCCTATTTTTTAACCGCGTCCATTTACACCTAAGCCTGAT
TAATTTGATATTGATAAACCTACAAAATGCAATTGTTGA


>TTHERM_00001080(protein)
MQDFYPKKKEEQVDTLFKFIIVGNASSGKTCLLHYFIEGKPKQNSTYTIGVEFGSKIEKV
GSKLVKFQIWDTAGQERFRSVARTYYRGAVGAVIVFDLTNIDSFHSLQNWVNDVRELANK
EVCIVVCGNKSDLTDERAVQSHEAKRQCESLDVEYIETSALTGENVNEAFSIITKTILQK
IENNQMEPIFQPRPFTPKPDQFDIDKPTKCNC


>TTHERM_00001080(gene)
ATGTAGGATTTTTACCCTAAAAAGAAGGAAGAATAGGTTGACACTCTTTTTAAATTCATA
ATAGTAGGAAATGCTTCATCAGGAAAGACATGCTTGTTACATTATTTTATAGAAGGAAAG
CGTAATTAATTACAAAATTTAAAGCAGACAATAATAAAATATGAATTTTAATTTGCCATT
TAATTGAAACAATAGATAGATTGATTAATATATGTTTATTTAGATTAAGCAAAACGCTAA
AAAAATTAAAATATTTATATATTTTAACAGCAAAATAAAATTCAACTTATACTATTGGTG
TTGAATTTGGGTCTAAAATTGAAAAGGTTGGATCAAAGCTAGTTAAATTTTAAATTTGGG
ATACTGCAGGATAGGAAAGATTTAGATCAGTAGCACGCACATATTATAGGGGAGCAGTAG
GAGCAGTAATCGTTTTTGATCTGACAAAGTAAAATATTAGTTAGAAATCAATAAATATTT
TGAAAATACAAGAAGAAATTATTTACATTTCATTCTAACCTTATTTTTTAATACTTATTT
CACAGCATAGATTCATTTCACTCACTTTAAAATTGGGTCAATGATGTTAGAGAATTAGCA
AATAAGGAAGTATGTATTGTAGTTTGTGGAAATAAATCTGATTTGACAGATGAACGTGCA
GTTTAAAGTCATGAAGCAAAACGTTAATGTGAAAGTCTAGATGTAGAATACATCGAAACA
AGCGCATTAACTGGTGAAAATGTAAATGAAGCATTTTCTATTATAACTAAGACTATTTTG
CAAAAAATAGAAAATAATTAAATGGGTAATAAATACTATTTAAAATAAATATTAATTGTT
AGATTTTATGAAATATTTTTTTTAAAATTAAATAATTTTATCTTTTATCATTTTTATTAA
AAGAGCCTATTTTTTAACCGCGTCCATTTACACCTAAGCCTGATTAATTTGATATTGATA
AACCTACAAAATGCAATTGTTGA