Identifiers and Description

Gene Model Identifier

TTHERM_00201690

Standard Name

RAB49

Aliases

PreTt13740 | 17.m00347

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00201690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01991.11.000382677035467e-28hypothetical protein (178 aa)
DictyBaseDDB_G02924068.999890565246037e-26rab4 on chromosome: 6 position
1558648 to 1559514
OxytrichaContig5831.0.g69.996273942859018e-26Ras family
WormBaseWBGene000193171.0004572433669413e-23status:Confirmed UniProt:Q21
137 protein_id:CCD72274.1
SGDYFL005W5.0000961330688895e-23SEC4 Rab family GTPase essenti
al for vesicle-mediated exocyt
ic secretion and autophagy; as
sociates with the exocyst comp
onent Sec15p and may regulate
polarized delivery of transpor
t vesicles to the exocyst at t
he plasma membrane

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00201690(coding)
ATGTCTGCTAAAAACGACAGTAAATAAAAAATTATAAAATGTGCTTCAGTGGGAGATTAA
TTTGTTGGAAAATCTGCTCTATTTGTTAGGTAATTTCATGGAAAGTTTCTTCGATAAAAA
ACCGCTGGAGTTGATTTTTAAATTTTCGTTCTGAAAAAAGGAAATGAAGAAATTAAATTT
TAGTTTTGGGATTTAGGTTATAGGAGTAGATAAGAAGGATTAAAAGTTTATCCTTAAACT
TCTATTTTAATTATGATTTATGATATTACAAACAGAATCTCTTTTACAAATATTTAAAAA
TATTATGGAGATTATGTTAGATAAGGAAATAAAAAATCAATAATTGCTCTTGTCGGAAAT
AAGAAGGATCTAAATGAATATAGAGAAGTTTCATTTTTGGAAGGTTAAGAGCTGGGTAAA
TAGTTAGGTGTATATTTTTTTGAAGTATCTGCTTTTACAGGTGAAAATGTTAAAGATTTG
TATGAGTTCTTAATAGATAAGTCTATTGATACAGTCTAATTTTGA


>TTHERM_00201690(protein)
MSAKNDSKQKIIKCASVGDQFVGKSALFVRQFHGKFLRQKTAGVDFQIFVLKKGNEEIKF
QFWDLGYRSRQEGLKVYPQTSILIMIYDITNRISFTNIQKYYGDYVRQGNKKSIIALVGN
KKDLNEYREVSFLEGQELGKQLGVYFFEVSAFTGENVKDLYEFLIDKSIDTVQF


>TTHERM_00201690(gene)
ATGTCTGCTAAAAACGACAGTAAATAAAAAATTATAAAATGTGCTTCAGTGGGAGATTAA
TTTGTTGGAAAATCTGCTCTATTTGTTAGGTAATTTCATGGAAAGTTTCTTCGATAAAAA
ACCGCTGGAGTTGATTTTTAAATTTTCGTTCTGAAAAAAGTAAAATAAATATTTCGAATT
TATTTTTTTTAATAGATTTTATACATTTTAGGGAAATGAAGAAATTAAATTTTAGTTTTG
GGATTTAGGTTATAGGAGTAGATAAGAAGGATTAAAAGTTTATCCTTAAACTTCTATTTT
AATTATGATTTATGATATTACAAACAGAATCTCTTTTACAAATATTTAAAAATATTATGG
AGATTATGTTAGATAAGGAAATAAAAAATCAATAATTGCTCTTGTCGGAAATAAGAAGGA
TCTAAATGAATATAGAGAAGTTTCATTTTTGGAAGGTTAAGAGCTGGGTAAATAGTTAGG
TGTATATTTTTTTGAAGTATCTGCTTTTACAGGTGAAAATGTTAAAGATTTGTATGAGTT
CTTAATAGATAAGTCTATTGATACAGTCTAATTTTGA