Identifiers and Description

Gene Model Identifier

TTHERM_00201680

Standard Name

RAB48 (RAB GTPase 48)

Aliases

PreTt13739 | 17.m00346

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00201680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_41344.15.999207186122604e-25hypothetical protein (168 aa)
OxytrichaContig14371.0.g323.9989916100764785e-24Ras family
SGDYFL005W4.0006511639687014e-23SEC4 Rab family GTPase essenti
al for vesicle-mediated exocyt
ic secretion and autophagy; as
sociates with the exocyst comp
onent Sec15p and may regulate
polarized delivery of transpor
t vesicles to the exocyst at t
he plasma membrane
DictyBaseDDB_G02924061.9994498063102785e-22rab4 on chromosome: 6 position
1558648 to 1559514
WormBaseWBGene000193179.997019043202629e-21status:Confirmed UniProt:Q21
137 protein_id:CCD72274.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00201680(coding)
ATGTCTACTTAAAATGATAGCATATAAAAAACGATAAAGTGTATTTTAGTGGGAGATAGA
TTTGTTGGAAAATCTGCTATATTTTATTCGCATATTTATGAAAAGGTTGTTCAATATCTA
ACTAATCAAGCTGATTGTTAAGTTTTGAGATTGAAAAAAGGAAATGTAGAAATTAAATTT
TAATTTTGGGATTTGAACGAGCTGACAAGAGAAAAAACATTAAAATATTATCGTTAAACT
TCTATTTTAATGATAATTTACGATGTTACAAACAGAAACTCATTTACAAATATTAAAAAT
TATTATAAAGATTTTGTTGAATAAGAAAACCAATAATCAATTATTGCTCTTGTTGGAAAT
AAAAAGGATCTAAATGAGTCTAGATTAGTTTCATTTTTTGAGGGTTAAAATCTAGCCAAG
TCGTTAGGTGTAGAGTTTTTTGAAGTATCTGCTTTTACGGGTGATAAAATTAAAGATTTG
TATGACTTCTTAATGAATAAATAAATTGATTTTGTCGAATATTGA


>TTHERM_00201680(protein)
MSTQNDSIQKTIKCILVGDRFVGKSAIFYSHIYEKVVQYLTNQADCQVLRLKKGNVEIKF
QFWDLNELTREKTLKYYRQTSILMIIYDVTNRNSFTNIKNYYKDFVEQENQQSIIALVGN
KKDLNESRLVSFFEGQNLAKSLGVEFFEVSAFTGDKIKDLYDFLMNKQIDFVEY


>TTHERM_00201680(gene)
ATGTCTACTTAAAATGATAGCATATAAAAAACGATAAAGTGTATTTTAGTGGGAGATAGA
TTTGTTGGAAAATCTGCTATATTTTATTCGCATATTTATGAAAAGGTTGTTCAATATCTA
ACTAATCAAGCTGATTGTTAAGTTTTGAGATTGAAAAAAGTAAAAATAAATATTTCATAT
TAGTTTATCTAGTATATTTTATATATTTTAGGGAAATGTAGAAATTAAATTTTAATTTTG
GGATTTGAACGAGCTGACAAGAGAAAAAACATTAAAATATTATCGTTAAACTTCTATTTT
AATGATAATTTACGATGTTACAAACAGAAACTCATTTACAAATATTAAAAATTATTATAA
AGATTTTGTTGAATAAGAAAACCAATAATCAATTATTGCTCTTGTTGGAAATAAAAAGGA
TCTAAATGAGTCTAGATTAGTTTCATTTTTTGAGGGTTAAAATCTAGCCAAGTCGTTAGG
TGTAGAGTTTTTTGAAGTATCTGCTTTTACGGGTGATAAAATTAAAGATTTGTATGACTT
CTTAATGAATAAATAAATTGATTTTGTCGAATATTGA