Identifiers and Description

Gene Model Identifier

TTHERM_000207258

Standard Name

RAB47 (Rab)

Aliases

None

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_000207258

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_50970

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000207258(coding)
ATGTAGGAAAGTCATCTTTATATTAGAGATATGATTAAGGAAAGTTTATTAACTCTCTTA
ATTTAAGCGTCCTCGATTTTTACTCAAAAACTATTAAGTTAGGAGAGGAACAAATTAAAT
TTTAATTTTGGGATTATCAATCTTGCCAAAGAGAAGTTTCTTTATCACAAATTTTTTATA
AATAATGCTCAATAGTTATGA


>TTHERM_000207258(protein)
MQESHLYIRDMIKESLLTLLIQASSIFTQKLLSQERNKLNFNFGIINLAKEKFLYHKFFI
NNAQQL


>TTHERM_000207258(gene)
ATGTAGGAAAGTCATCTTTATATTAGAGATATGATTAAGGAAAGTTTATTAACTCTCTTA
ATTTAAGCGTCCTCGATTTTTACTCAAAAACTATTAAGTTAGTAAAAATTAATTATTCTA
CAAAATCTAAATAAAAATGTTTGACATTATTTTTAATAGGGAGAGGAACAAATTAAATTT
TAATTTTGGGATTATCAATCTTGCCAAAGAGAAGTTTCTTTATCACAAATTTTTTATAAA
TAATGCTCAATAGTTATGA