Identifiers and Description

Gene Model Identifier

TTHERM_00209270

Standard Name

RAB46 (RAB GTPase 46)

Aliases

PreTt13805 | 17.m00412

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00209270

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig5831.0.g65.002276765025871e-34Ras family
Tetrahymena borealisEI9_01991.12.0003218023735366e-33hypothetical protein (178 aa)
DictyBaseDDB_G02721389.000751454575209e-33rab2B on chromosome: 2 positio
n 1483407 to 1484594
SGDYOR089C3.00033207980219e-32VPS21 Rab family GTPase requir
ed for endocytic transport and
for sorting of vacuolar hydro
lases; localized in endocytic
intermediates; detected in mit
ochondria; geranylgeranylation
required for membrane associa
tion; mammalian Rab5 homolog
WormBaseWBGene000042689.99967697349061e-30locus:rab-5 status:Partially
_confirmed UniProt:P91857
protein_id:CAB04205.1
Stentor CoeruleusSteCoe_381740.00000000000003442477108469977

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00209270(coding)
ATGATTCATCAAACAGAGTAGTATAAAATTATGAAAGTAGCTTAAATAGGAGGTGGGTAT
ACAGGAAAGTCATCTTTATATTTGAGATATCTTTAAGGAGAGTTTATTGACAACCCTAAT
TATATTGGCGTTGAATTTTATACAAAAACTATTAAGATAGCAGAGGAACAAATTAAATTT
TAATTTTGGGATTGTCACTTGAACGAAAAAATCTATTCTTTATATCAAAATTATTTTAAA
TAATGTTCAATAGTTATGATATCTTATGACATTACTAATAGATACTCCTTTGATAGAGCG
CAATTATGGTGTAAAGATTACAATTAAAAAAAATTAAATAAAGTAGCTCTACTAGCTTTG
ATTGGAAATAAATGCGATTTAGAATAATAAAGGTAAGTTTCATATCAAGAGGGTAAACAT
ATTGCAAAGTCTTTAGGAATGCTATTCTTCGAAGTCTCCTCTAAAACAGGTTATTAAGTA
AATGAGCTGTTTGAAAGTTTAATAAGCTACGTGATCAATATTAATTGA


>TTHERM_00209270(protein)
MIHQTEQYKIMKVAQIGGGYTGKSSLYLRYLQGEFIDNPNYIGVEFYTKTIKIAEEQIKF
QFWDCHLNEKIYSLYQNYFKQCSIVMISYDITNRYSFDRAQLWCKDYNQKKLNKVALLAL
IGNKCDLEQQRQVSYQEGKHIAKSLGMLFFEVSSKTGYQVNELFESLISYVININ


>TTHERM_00209270(gene)
ATGATTCATCAAACAGAGTAGTATAAAATTATGAAAGTAGCTTAAATAGGAGGTGGGTAT
ACAGGAAAGTCATCTTTATATTTGAGATATCTTTAAGGAGAGTTTATTGACAACCCTAAT
TATATTGGCGTTGAATTTTATACAAAAACTATTAAGATAGTAAAAATTAATTATTCTACA
AAATCTAAATAAAAATGTTTGATTTTATTTTTAATAGGCAGAGGAACAAATTAAATTTTA
ATTTTGGGATTGTCACTTGAACGAAAAAATCTATTCTTTATATCAAAATTATTTTAAATA
ATGTTCAATAGTTATGATATCTTATGACATTACTAATAGATACTCCTTTGATAGAGCGCA
ATTATGGTGTAAAGATTACAATTAAAAAAAATTAAATAAAGTAGCTCTACTAGCTTTGAT
TGGAAATAAATGCGATTTAGAATAATAAAGGTAAGTTTCATATCAAGAGGGTAAACATAT
TGCAAAGTCTTTAGGAATGCTATTCTTCGAAGTCTCCTCTAAAACAGGTTATTAAGTAAA
TGAGCTGTTTGAAAGTTTAATAAGCTACGTGATCAATATTAATTGA