Identifiers and Description

Gene Model Identifier

TTHERM_01407950

Standard Name

RAB43 (RAB family protein)

Aliases

PreTt19979 | 372.m00017

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01407950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08464.12.998800627344286e-26hypothetical protein (171 aa)
OxytrichaContig15751.0.0.g871.9999391735788327e-19Ras family
WormBaseWBGene000042677.001446474249442e-19locus:rab-3 Ras-related prot
ein Rab-3 status:Confirmed
UniProt:Q94986 protein_id:C
CD65021.1
DictyBaseDDB_G02717366.997351175151406e-18rabC on chromosome: 2 position
718547 to 719569
SGDYLR262C9.997764199084386e-16YPT6 Rab family GTPase, Ras-li
ke GTP binding protein involve
d in the secretory pathway, re
quired for fusion of endosome-
derived vesicles with the late
Golgi, maturation of the vacu
olar carboxypeptidase Y; has s
imilarity to the human GTPase,
Rab6

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01407950(coding)
ATGCTTAATAAACTTTTATTTTGTATCTATTTGAAAAAAAATATTTAATTTATTATAAAT
ATATATTTTTATTTTATTAAAATTTGCTTAGATTGCCTGTAAAAAAGTAAAATGAAATAA
GACTTACAAACTAAAGAAATCTTACTAAAAATCTTTATAGATGGTGGGCCCTAGATTGGA
AAATAAACTTTGGCTAAGCGATTTATTGATGATGAATTTATTTAATTGACATAATTGCAT
AAACTTTTAGATTTTAATATCTACAGAACAGAATATTATAATTAAAAGTTGAAAATAAAG
ATCTTTTCTTTTAGATAGCATCTTTGTAGATATGAACTAGTAATTAAAAAGCTTCATTAA
GACTCTAATACTCTTATTTTTGCTTATGATATCACAAAAAGAGAGTCATTTGATGACTTA
CAAGAAAGAATACAAACATTTATGTCATAATAATTTTCAAAAAATATGATTGTTTTTCTT
ATAGGACTAAAGAAAGATCTATCCGATTAAAGATAGGTATCAAAAAATGAAGCAAAATAA
ATTGCTGACTCATTTGGGATGCATTTTTTTGAAATCTCCTCTAAATAGAATATTAATATA
TTTGAAATGTTTGATCTTGCAATAAGAGAATCTTTAGATAAATTTTATTTATTTAAAAAT
CTATGA


>TTHERM_01407950(protein)
MLNKLLFCIYLKKNIQFIINIYFYFIKICLDCLQKSKMKQDLQTKEILLKIFIDGGPQIG
KQTLAKRFIDDEFIQLTQLHKLLDFNIYRTEYYNQKLKIKIFSFRQHLCRYELVIKKLHQ
DSNTLIFAYDITKRESFDDLQERIQTFMSQQFSKNMIVFLIGLKKDLSDQRQVSKNEAKQ
IADSFGMHFFEISSKQNINIFEMFDLAIRESLDKFYLFKNL


>TTHERM_01407950(gene)
ATGCTTAATAAACTTTTATTTTGTATCTATTTGAAAAAAAATATTTAATTTATTATAAAT
ATATATTTTTATTTTATTAAAATTTGCTTAGATTGCCTGTAAAAAAGTAAAATGAAATAA
GACTTACAAACTAAAGAAATCTTACTAAAAATCTTTATAGATGGTGGGCCCTAGATTGGA
AAATAAACTTTGGCTAAGCGATTTATTGATGATGAATTTATTTAATTGACATAATTGCAT
AAACTTTTAGATTTTAATATCTACAGAACAGAATATGTAAGAATAGTTATTATTAATTAA
TCTTGAATGTAAGTATTTATTATATTTTTATTTATTTAGTATAATTAAAAGTTGAAAATA
AAGATCTTTTCTTTTAGATAGCATCTTTGTAGATATGAACTAGTAATTAAAAAGCTTCAT
TAAGACTCTAATACTCTTATTTTTGCTTATGATATCACAAAAAGAGAGTCATTTGATGAC
TTACAAGAAAGAATACAAACATTTATGTCATAATAATTTTCAAAAAATATGATTGTTTTT
CTTATAGGACTAAAGAAAGATCTATCCGATTAAAGATAGGTATCAAAAAATGAAGCAAAA
TAAATTGCTGACTCATTTGGGATGCATTTTTTTGAAATCTCCTCTAAATAGAATATTAAT
ATATTTGAAATGTTTGATCTTGCAATAAGAGAATCTTTAGATAAATTTTATTTATTTAAA
AATCTATGA