Identifiers and Description

Gene Model Identifier

TTHERM_00149430

Standard Name

RAB3A (RAB GTPase 3A)

Aliases

PreTt20702 | 12.m00376 | 3700.m00098

Description

Rab III family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( PF03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 19%

TetraMine Data

TTHERM_00149430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05004.11.9996807727516527e-135Ras family protein (207 aa)
OxytrichaContig22392.0.g292.9987037581344066e-55Ras family
WormBaseWBGene000042677.001890014428386e-55locus:rab-3 Ras-related prot
ein Rab-3 status:Confirmed
UniProt:Q94986 protein_id:C
CD65021.1
DictyBaseDDB_G02763992.9994376937714457e-52rab8B on chromosome: 2 positio
n 6878753 to 6879364
SGDYFL005W3.0006824396935516e-51SEC4 Rab family GTPase essenti
al for vesicle-mediated exocyt
ic secretion and autophagy; as
sociates with the exocyst comp
onent Sec15p and may regulate
polarized delivery of transpor
t vesicles to the exocyst at t
he plasma membrane
Stentor CoeruleusSteCoe_111431.7587922024243116e-25

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00149430(coding)
ATGAAGGTCAAAGATTAAATGTTTAAGGTTCTAATTTTAGGTGATCCAGCAGTCGGAAAA
TCTTGTTTATTGCTTTAGTATTGCGATTAAACTTTTTAACCAACTCATGTTGCCACTGTT
GGTATTGATTTTAAAATGAAAGTACTCCAAATACAAGATTCAACTGTAAAGATGCAATTA
TGGGATACAGCAGGTTAAGAAAGATATCAAACATTAGCATCTACATTATATAAAGGCGCT
ATGGGTATAGTACTAGTTTATTCTGTTGATAATAGAAAAGCATTCGATGGTATTGCTAGA
TGGGTCAAATAAATCAAAGAAAACACAAACGAAAGTATTTAGATCATATTAGTGGCTAAT
AAAAGTGATTTACCCAATAAATAAGTATCAACAGCTGATGGAAGAAGATTAGCTGAACAG
TACTAGCTCGATTTCTTCGAAGTATCTGCAATGACAGGTGAAAATGTTAAGAATGCATTT
GAAACTCTTGCTAATAAAATTTATGCTCATATGAAACAAAATCCACCTCCAGTAGCTTAA
GAATAAGAAACTGGAAAAAAATTAACTGTTGCCTAAGCAACTACAACAACACCTTCTAAG
CAAAAGGGTTGTGCATGTGGTTGA


>TTHERM_00149430(protein)
MKVKDQMFKVLILGDPAVGKSCLLLQYCDQTFQPTHVATVGIDFKMKVLQIQDSTVKMQL
WDTAGQERYQTLASTLYKGAMGIVLVYSVDNRKAFDGIARWVKQIKENTNESIQIILVAN
KSDLPNKQVSTADGRRLAEQYQLDFFEVSAMTGENVKNAFETLANKIYAHMKQNPPPVAQ
EQETGKKLTVAQATTTTPSKQKGCACG


>TTHERM_00149430(gene)
ATGAAGGTCAAAGATTAAATGTTTAAGGTTCTAATTTTAGGTGATCCAGCAGTCGGAAAA
TCTTGTTTATTGCTTTAGTATTGCGATTAAACTTTTTAACCAACTCATGTTGCCACTGTT
GGTAAATAGAATATATTAAAATTTTCAATAGCTACATAAGCGAATAGTTTAATATTTTAA
AATGAAATTTAAATCATTTGCTTAAAAAAAAAAACATTCTAAAAACAAAAATTAAAGGAC
AATAGGACTTAAAATTAAAATATTATTAAAATATAGGTATTGATTTTAAAATGAAAGTAC
TCCAAATACAAGATTCAACTGTAAAGATGCAATTATGGGATACAGCAGGTTAAGAAAGAT
ATCAAACATTAGCATCTACATTATATAAAGGCGCTATGGGTATAGTACTAGTTTATTCTG
TTGATAATAGAAAAGCATTCGATGGTATTGCTAGATGGGTCAAGTAAAATAAATATTATT
ACTTAAATTAGAGTTATTTATTTTCATAAACTCTACAAAATAAAATTCAAATTTTCCATA
AGTTTATTCTTTGCAAATATAAATAAATAAATATCTAAATTTCTAAATATAAAATAGATA
AATCAAAGAAAACACAAACGAAAGTATTTAGATCATATTAGTGGCTAATAAAAGTGATTT
ACCCAATAAATAAGTATCAACAGCTGATGGAAGAAGATTAGCTGAACAGTACTAGCTCGA
TTTCTTCGAAGTATCTGCAATGACAGGTGAAAATGTTAAGAATGCATTTGAAACTCTTGC
TAATAAAATTTATGCTCATATGAAACAAAATCCACCTCCAGTAGCTTAAGAATAAGAAAC
TGGAAAAAAATTAACTGTTGCCTAAGCAACTACAACAACACCTTCTAAGCAAAAGGGTTG
TGCATGTGGTTGA