Identifiers and Description

Gene Model Identifier

TTHERM_00188280

Standard Name

RAB39

Aliases

PreTt08578 | 15.m00289 | 3697.m00001

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.8%

TetraMine Data

TTHERM_00188280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06367.14.0002634815779907e-110Ras family protein (224 aa)
DictyBaseDDB_G02763993.0007793728221555e-22rab8B on chromosome: 2 positio
n 6878753 to 6879364
OxytrichaContig7494.0.g648.002082816694397e-20Ras family
SGDYFL038C1.9999391735788327e-19YPT1 Rab family GTPase, involv
ed in the ER-to-Golgi step of
the secretory pathway; complex
formation with the Rab escort
protein Mrs6p is required for
prenylation of Ypt1p by prote
in geranylgeranyltransferase t
ype II (Bet2p-Bet4p)
WormBaseWBGene000042734.998394530072393e-19locus:rab-10 status:Confirme
d UniProt:Q94148 protein_i
d:CCD70773.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00188280(coding)
ATGAATAAAAGCATTTCATTAACTAGTAAAAAGCACTACAGTATTTTGTTGATAGGAGGT
ACTGGTGTAGGTAAATCATGCCTGAAAAATCGTATAATAAGAAAAAAATTTTAAACTGAA
ATAAGTACAGTAGGTGTAAATTAGCAACATTTAGACTACACTTATAAAAATAAGCAAATT
AAGCTGATGATTACTGATACTGCAGGATAGGAGTAATTTAAATCTATTACCAAATCATAT
TATAAAGATTGTTTTGCAGTCTTATTCTGTTTTTCGGGAGACTCACCTAGAAGCTTGAAA
GAAGCTGAACATTATGCAAGACAATTTTAAGTAAATTACTAAAATAGCAAGGCTCCTGAA
GGTTTTGCACCAATTTGCTTGTTCGTAAGAAACAAATGTGATATGTCTGAAAATATTTTC
ACTTAGAATGTTATAGATAACACTATAAATGGAATTTCAGAGTTGTATTAGGAATTCAAA
GGTTTCTAAAACATTAAGTTTTTTGAAGTAAGCGCTAAAGAAGGAACTAATACAGAAAGC
TTACTTTAGTATGTTGTTGAAGAACTAGACAAATAAAATGTATTCGATATAAAGGAATAG
AATGGAACTGTTATTCTCAATTAGAATTAGGATAAAAACTAGGAAAAAAATAATGAATCA
TCATCTTCTGGTTGTTGTAAATGA


>TTHERM_00188280(protein)
MNKSISLTSKKHYSILLIGGTGVGKSCLKNRIIRKKFQTEISTVGVNQQHLDYTYKNKQI
KLMITDTAGQEQFKSITKSYYKDCFAVLFCFSGDSPRSLKEAEHYARQFQVNYQNSKAPE
GFAPICLFVRNKCDMSENIFTQNVIDNTINGISELYQEFKGFQNIKFFEVSAKEGTNTES
LLQYVVEELDKQNVFDIKEQNGTVILNQNQDKNQEKNNESSSSGCCK


>TTHERM_00188280(gene)
ATGAATAAAAGCATTTCATTAACTAGTAAAAAGCACTACAGTATTTTGTTGATAGGAGGT
ACTGGTGTAGGTAAATCATGCCTGAAAAATCGTATAATAAGAAAAAAATTTTAAACTGAA
ATAAGTACAGTAGGTATTACACATTTATAATTAATTAGCTATTAATTTTAGTTTTCTAAT
TATATCATTTTAAATGAACTAAAAAAGGTGTAAATTAGCAACATTTAGACTACACTTATA
AAAATAAGCAAATTAAGCTGATGATTACTGATACTGCAGGATAGGAGTAATTTAAATCTA
TTACCAAATCATATTATAAAGATTGTTTTGCAGTCTTATTCTGTTTTTCGGGAGACTCAC
CTAGAAGCTTGAAAGAAGCTGAACATTATGCAAGACAATTTTAAGTAAATTACTAAAATA
GCAAGGCTCCTGAAGGTTTTGCACCAATTTGCTTGTTCGTAAGAAACAAATGTGATATGT
CTGAAAATATTTTCACTTAGAATGTTATAGATAACACTATAAATGGAATTTCAGAGTTGT
ATTAGGAATTCAAAGGTTTCTAAAACATTAAGTTTTTTGAAGTAAGCGCTAAAGAAGGAA
CTAATACAGAAAGCTTACTTTAGTATGTTGTTGAAGAACTAGACAAATAAAATGTATTCG
ATATAAAGGAATAGAATGGAACTGTTATTCTCAATTAGAATTAGGATAAAAACTAGGAAA
AAAATAATGAATCATCATCTTCTGGTTGTTGTAAATGA