Identifiers and Description

Gene Model Identifier

TTHERM_00723010

Standard Name

RAB38 (RAB GTPase 38)

Aliases

PreTt18061 | 116.m00086 | 3671.m00010

Description

Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.8%

TetraMine Data

TTHERM_00723010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14782.12.0006174947921314e-117Ras family protein (216 aa)
WormBaseWBGene000042731.0002124404074584e-26locus:rab-10 status:Confirme
d UniProt:Q94148 protein_i
d:CCD70773.1
DictyBaseDDB_G02721382.0009605191578312e-25rab2B on chromosome: 2 positio
n 1483407 to 1484594
SGDYOR089C5.00094715178354e-25VPS21 Rab family GTPase requir
ed for endocytic transport and
for sorting of vacuolar hydro
lases; localized in endocytic
intermediates; detected in mit
ochondria; geranylgeranylation
required for membrane associa
tion; mammalian Rab5 homolog
OxytrichaContig15751.0.0.g871.999790113608142e-24Ras family
Stentor CoeruleusSteCoe_7590.00000000000009357622968840175

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00723010(coding)
ATGAACAATCATTAGTCTAGTTCATCTAACACAAAGATTATTATAGTTGGAGCAGGAGGA
ATTGGCAAATCAACTTTCATTTAGTATTATGTTAATGGAAAGTACCTTGTCCCAAACTCA
ACAGTTTTATGCGATTTCTTTGTGAAATAAGTTAAATACAAAAGCGAGTAGATAAGATTA
GAAATATGGGATACAGCTGGATAGCCATAATTTTAAAATTTAATTAGTCAGTTTTATAGA
AATACAAGTGCTGCAATACTTGCTTTTGATATTAATAACATTGAGTCATTACGTAAACTT
GATTTTTACTTTAATGATCTCAATAACTAACTAGGTTAGGATGTCATTAAGGTAATTATA
TCAACCAGATGTGATTTAAAGGGTATGAAATATGATGAAAAAAACAACCCAATTAAAGCT
GTAAGTGATGAAGAAATAAATTAATATGTGAAGGAAAAGGGTCTAAAATATTTTGAAACA
TCTTCTAAAGCAGATATAGGAGTAAAAGATACCTTCAATTATATAATCGAAGAAATCTTA
AAAAAGCAATCAATCGTAGGAACTGATAATACTCCAAACAATAATATTTCTCTTATAGAA
TAAAATTAATCACAAAAACCTCAGTAAAAAAAAGAGGGATGCTGCTCAAGTTGA


>TTHERM_00723010(protein)
MNNHQSSSSNTKIIIVGAGGIGKSTFIQYYVNGKYLVPNSTVLCDFFVKQVKYKSEQIRL
EIWDTAGQPQFQNLISQFYRNTSAAILAFDINNIESLRKLDFYFNDLNNQLGQDVIKVII
STRCDLKGMKYDEKNNPIKAVSDEEINQYVKEKGLKYFETSSKADIGVKDTFNYIIEEIL
KKQSIVGTDNTPNNNISLIEQNQSQKPQQKKEGCCSS


>TTHERM_00723010(gene)
ATGAACAATCATTAGTCTAGTTCATCTAACACAAAGATTATTATAGTTGGAGCAGGAGGA
ATTGGCAAATCAACTTTCATTTAGTATTATGTTAATGGAAAGTACCTTGTCCCAAACTCA
ACAGTTTGTAATCCATAATTCATTAATAGTTTCTAATAGCTAATATTAATCACTTTTTTT
TATATTTGAAAGTATGCGATTTCTTTGTGAAATAAGTTAAATACAAAAGCGAGTAGATAA
GATTAGAAATATGGGATACAGCTGGATAGCCATAATTTTAAAATTTAATTAGTCAGTTTT
ATAGAAATACAAGTGCTGCAATACTTGCTTTTGATATTAATAACATTGAGTCATTACGTA
AACTTGATTTTTACTTTAATGATCTCAATAACTAACTAGGTTAGGATGTCATTAAGGTAA
TTATATCAACCAGATGTGATTTAAAGGGTATGAAATATGATGAAAAAAACAACCCAATTA
AAGCTGTAAGTGATGAAGAAATAAATTAATATGTGAAGGAAAAGGGTCTAAAATATTTTG
AAACATCTTCTAAAGCAGATATAGGAGTAAAAGATACCTTCAATTATATAATCGAAGAAA
TCTTAAAAAAGCAATCAATCGTAGGAACTGATAATACTCCAAACAATAATATTTCTCTTA
TAGAATAAAATTAATCACAAAAACCTCAGTAAAAAAAAGAGGGATGCTGCTCAAGTTGA