Identifiers and Description

Gene Model Identifier

TTHERM_00852850

Standard Name

RAB32

Aliases

PreTt01184 | 150.m00076 | 3834.m00351

Description

Homolog of D. melanogaster Rab32; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00852850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15907.18.998057044852888e-147Ras family protein (236 aa)
OxytrichaContig5265.0.g83.9991604984848653e-48Ras family
DictyBaseDDB_G02836031.9991517704232713e-32rab32A on chromosome: 4 positi
on 965063 to 966191
WormBaseWBGene000042734.001714826231863e-32locus:rab-10 status:Confirme
d UniProt:Q94148 protein_i
d:CCD70773.1
SGDYFL038C7.996210139153865e-29YPT1 Rab family GTPase, involv
ed in the ER-to-Golgi step of
the secretory pathway; complex
formation with the Rab escort
protein Mrs6p is required for
prenylation of Ypt1p by prote
in geranylgeranyltransferase t
ype II (Bet2p-Bet4p)
Stentor CoeruleusSteCoe_339146.305116760146989e-16

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00852850(coding)
ATGAGTGACAACGTATTTATTAAGATTATTGTAGTAGGTGAATAAAATGTTGGTAAGACT
TGTATCTTAGCAAGATATTCCCGTGATTAGTTTGACACCACATGCCCTCCCACATTAGGT
ATGGACTTCTAATCTAAGTTACTTGAATACAAGGGAAAAACAATTAGATTGTAATTGTGG
GATATAGCAGGTCAGGAAAGATACAACTCTGTTTCTAAATTATATGTTAGAGGAGCCTAT
GGTGCTTTGATTGTAGCTGATGTCAAGGAAGAAGAGTCTTTGTAGAATACTCTTAAGTGG
AAGAAAATGATTGAAGACTCTTGCGATCAAAAGAATGGCAAACCTATTCCTATGATCCTC
GTTTAAAATAAAGTTGACGAATTAAAGGGAGTAGGACAAATTTAAGATTTCCAAAAAGAA
AGTTATTTAAAGAGTTTTGCCTAATAAAACGGATTCAATGGAGCTCTATAAGTTTCTGCA
AAAGACAACACCAATATTCCTGATATTTTCAATATGCTTATTGATGAAATTATAAGCTAA
GGCTTCCTCAGCAATTTTGATACTAGTGTTCCTGATAAGAACTATAATAGACCAAGTAAT
AATGATAATTATTCAAATCCTCAAAAAATCACTTCTTAACAATTGTAAAAAAATGCCCAA
TCTTCCTCTTCTTCAAAGAAAAACTCAGGAGGTTGCTGTTGA


>TTHERM_00852850(protein)
MSDNVFIKIIVVGEQNVGKTCILARYSRDQFDTTCPPTLGMDFQSKLLEYKGKTIRLQLW
DIAGQERYNSVSKLYVRGAYGALIVADVKEEESLQNTLKWKKMIEDSCDQKNGKPIPMIL
VQNKVDELKGVGQIQDFQKESYLKSFAQQNGFNGALQVSAKDNTNIPDIFNMLIDEIISQ
GFLSNFDTSVPDKNYNRPSNNDNYSNPQKITSQQLQKNAQSSSSSKKNSGGCC


>TTHERM_00852850(gene)
ATGAGTGACAACGTATTTATTAAGATTATTGTAGTAGGTGAATAAAATGTTGGTAAGACT
TGTATCTTAGCAAGATATTCCCGTGATTAGTTTGACACCACATGCCCTCCCACATTAGGT
ATGGACTTCTAATCTAAGTTACTTGAATACAAGGGAAAAACAATTAGATTGTAATTGTGG
GATATAGCAGGTCAGGAAAGATACAACTCTGTTTCTAAATTATATGTTAGAGGAGCCTAT
GGTGCTTTGATTGTAGCTGATGTCAAGGAAGAAGAGTCTTTGTAGAATACTCTTAAGTGG
AAGAAAATGATTGAAGACTCTTGCGATCAAAAGAATGGCAAACCTATTCCTATGATCCTC
GTTTAAAATAAAGTTGACGAATTAAAGGGAGTAGGACAAATTTAAGATTTCCAAAAAGAA
AGTTATTTAAAGAGTTTTGCCTAATAAAACGGATTCAATGGAGCTCTATAAGTTTCTGCA
AAAGACAACACCAATATTCCTGATATTTTCAATATGCTTATTGATGAAATTATAAGCTAA
GGCTTCCTCAGCAATTTTGATACTAGTGTTCCTGATAAGAACTATAATAGACCAAGTAAT
AATGATAATTATTCAAATCCTCAAAAAATCACTTCTTAACAATTGTAAAAAAATGCCCAA
TCTTCCTCTTCTTCAAAGAAAAACTCAGGAGGTTGCTGTTGA