Identifiers and Description

Gene Model Identifier

TTHERM_00670290

Standard Name

RAB2B (RAB GTPase 2B)

Aliases

PreTt01053 | 100.m00114 | 3731.m00024

Description

Rab II family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.2%

TetraMine Data

TTHERM_00670290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16443.11.9991914687114462e-138Ras family protein (216 aa)
WormBaseWBGene000068331.9996609186508915e-82locus:unc-108 status:Confirm
ed UniProt:O01577 protein_
id:CCD66422.1
OxytrichaContig22591.0.g1123.001096210761825e-82Ras family
DictyBaseDDB_G02922682.9993408039826107e-81rab2A on chromosome: 6 positio
n 1422661 to 1423817
SGDYGL210W2.9989272749380808e-50YPT32 Rab family GTPase, very
similar to Ypt31p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi
Stentor CoeruleusSteCoe_258451.8048513878454153e-35

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00670290(coding)
ATGTCATATGCTTATTTACTCAAATATATTGTTATTGGCGATACTGGTGTAGGAAAATCT
AGTCTCATTATGCAGTTTACATAAGAAGTATTTAGAGATAAACATGATATAACAGTAGGA
GTAGAATTTGGAGCCAAAGTTATAAAAATAAATGGATAAAGTGTAAAATTATAAATTTGG
GATACAGCAGGATAAGAAGATTTCAGAAGCATAGTACGTTCTTATTATAGATCTACTGCA
GGGGCTCTTGTAGTATATGATATAACTAGGAGAGATACATTTAAGCATATAACTAGATGG
GTAGAAGAAGCGACTAACAATGGGAATAGCACCTTAACCTTTATGCTTATTGGAAATAAA
TCTGACTTGGAAAGCTAGAGAGAAGTTAGTTATGAAGAAGGTTTATAGCTAGCTAAAGAA
CATAATATGCTATTTATAGAGACTTCAGCAAAGACCAAGCATAACGTAGAACAGACATTT
TGCTAGACAGCAGTAACTATCTTAGATAAAGTAAAAAATGGAGAAATAGAAGCAACTGCA
AATGGCTCTTCAGGTGTTAAATTAGGAGAAGTATAAAAGTAGGATAATATTATTTTAGAT
AGTAACAGCGCCAAGAATAATAATAATGGTAACAAAAAAAAGAAAAACTGTTGCTGA


>TTHERM_00670290(protein)
MSYAYLLKYIVIGDTGVGKSSLIMQFTQEVFRDKHDITVGVEFGAKVIKINGQSVKLQIW
DTAGQEDFRSIVRSYYRSTAGALVVYDITRRDTFKHITRWVEEATNNGNSTLTFMLIGNK
SDLESQREVSYEEGLQLAKEHNMLFIETSAKTKHNVEQTFCQTAVTILDKVKNGEIEATA
NGSSGVKLGEVQKQDNIILDSNSAKNNNNGNKKKKNCC


>TTHERM_00670290(gene)
ATGTCATATGCTTATTTACTCAAATATATTGTTATTGGCGATACTGTAATTTTTTAAGAA
TTAGCTTTTATTTCAGATTCTAAATAAAGTTCAAATAGCATACCTTTATCTTTTTTGCAT
AATTCAGATAAAAGCTAATATTTAGTAAGCAAATATGAAATATATTTTATATGATAAAGG
GTGTAGGAAAATCTAGTCTCATTATGCAGTTTACATAAGAAGTATTTAGAGATAAACATG
ATATAACAGTAGGAGTAGAATTTGGAGCCAAAGTTATAAAAATAAATGGATAAAGTGTAA
AATTATAAATTTGGGATACAGCAGGATAAGAAGATTTCAGAAGCATAGTACGTTCTTATT
ATAGATCTACTGCAGGGGCTCTTGTAGTATATGATATAACTAGGTATATTAATTAAAGAA
TACTTGCAATACTTTCAATTATGATAAACCTATTCATTCATTTTGATATAATGCTTTTTA
AATTATTCATAGGAGAGATACATTTAAGCATATAACTAGATGGGTAGAAGAAGCGACTAA
CAATGGGAATAGCACCTTAACCTTTATGCTTATTGGAAATAAATCTGACTTGGAAAGCTA
GTAAATTTAATTTGTATTTAAGTAAGTTATATAACATCGTATTTTATTCATTTTAGGAGA
GAAGTTAGTTATGAAGAAGGTTTATAGCTAGCTAAAGAACATAATATGCTATTTATAGAG
ACTTCAGCAAAGACCAAGCATAACGTAGAACAGGTATTACTATATTAATTATAAGCAAAG
TTAATGTTTATCTTAATAAAAGACATTTTGCTAGACAGCAGTAACTATCTTAGATAAAGT
AAAAAATGGAGAAATAGAAGCAACTGCAAATGGCTCTTCAGGTGTTAAATTAGGAGAAGT
ATAAAAGTAGGATAATATTATTTTAGATAGTAACAGCGCCAAGAATAATAATAATGGTAA
CAAAAAAAAGAAAAACTGTTGCTGA