Identifiers and Description

Gene Model Identifier

TTHERM_01164080

Standard Name

RAB28 (RAB GTPase 28)

Aliases

PreTt18012 | 260.m00019 | 3796.m00117

Description

Homolog of H. sapiens Rab28; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.6%

TetraMine Data

TTHERM_01164080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20814.13.001349705199738e-130Ras family protein (219 aa)
OxytrichaContig22405.0.g937.998932288246191e-33Ras family
WormBaseWBGene000042714.9988726541653934e-26locus:rab-7 status:Confirmed
UniProt:Q23146 protein_id
:CAA91357.1
DictyBaseDDB_G02849857.002116201343823e-26rab1D on chromosome: 4 positio
n 2756032 to 2757408
SGDYML001W3.001290106883431e-24YPT7 Rab family GTPase; GTP-bi
nding protein of the rab famil
y; required for homotypic fusi
on event in vacuole inheritanc
e, for endosome-endosome fusio
n, similar to mammalian Rab7
Stentor CoeruleusSteCoe_219830.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01164080(coding)
ATGGATCAAGAAGACAAAGAAATTAAATTTAGTAAAAAGATATTAGTTATAGGTGAAGCA
GGTGTAGGAAAGTCCGCCATCATTTAAAAGTATGTCAATAACTTCTATCCTGAAATGTAC
AAGCAATCACTTGGATGCAATTTTTTTAGCAAACAATTAGACCTTTCAAAGACTGCATCA
GTAACTTTGAGCATATGGGATTGCAGCAGTGAAAGCTTAAAATCTAAAATGCTTAATACT
TATATATATGGATCAGATGCAGTTCTTTTTGTTTACGACATAACTAACAGAAGCAGCTTT
GACTCTATTCGTAATATTATGAAGCTAGTTTAATCTGTTTTGATAGAAAATAACGATGTA
GAGTATTGTGTTTTAGGAAATAAAAATGATTTATTCAATTAAATAGCTGTTGAAGAGGAT
TAAGCGAAAGAAATGTGTAAAATACTCAATCTCCCCTACTATTCTGTTTCAGCTAAAATG
GGATCCAATCTTAACGAATGTTTTAAAAATATAGCATACAAAGTCTGCAAATTACCTTTC
CCTTCAGAAGAAAAGAAAAATGATAAAAGCTTAGAAGGATCTATTCCAGATTTAAGAAGT
GAAGTAAAGGGAAGTAATGGAGACAACAAGACATCAAGTGGATGCAACATATTTTGA


>TTHERM_01164080(protein)
MDQEDKEIKFSKKILVIGEAGVGKSAIIQKYVNNFYPEMYKQSLGCNFFSKQLDLSKTAS
VTLSIWDCSSESLKSKMLNTYIYGSDAVLFVYDITNRSSFDSIRNIMKLVQSVLIENNDV
EYCVLGNKNDLFNQIAVEEDQAKEMCKILNLPYYSVSAKMGSNLNECFKNIAYKVCKLPF
PSEEKKNDKSLEGSIPDLRSEVKGSNGDNKTSSGCNIF


>TTHERM_01164080(gene)
ATGGATCAAGAAGACAAAGAAATTAAATTTAGTAAAAAGATATTAGTTATAGGTGAAGCA
GGTGTAGGAAAGTCCGCCATCATTTAAAAGTATGTCAATAACTTCTATCCTGAAATGTAC
AAGCAATCACTTGGATGCAATTTTTTTAGCAAAGTAAGTTAATAAATGATTTATCAATAA
ACATATGTGAAATATTATTTTAAAGCAATTAGACCTTTCAAAGACTGCATCAGTAACTTT
GAGCATATGGGATTGCAGCAGTATGATTTTTTAATATTTATAGCTAATAAAAACACAATT
TTTTATCAGGTGAAAGCTTAAAATCTAAAATGCTTAATACTTATATATATGGATCAGATG
CAGTAAAATTATTAGCTGATATATTTATTTTCATAAATTTAGAATTTTTAAATATCTAAA
TTGAGGTTCTTTTTGTTTACGACATAACTAACAGAAGCAGCTTTGACTCTATTCGTAATA
TTATGAAGCTAGTTTAATCTGTTTTGATAGAAAATAACGATGTAGAGTATTGTGTTTTAG
GAAATAAAAATGATTTATTCAATTAAATAGCTGTTGAAGAGGATTAAGCGAAAGAAGTAA
ACTTTTTTAAATAAACAAGCAATTTTTTTATTAAGTTGTCTTGCTAGCATGACATGAAAA
ATATTTTAAAATAATTATTTTAGATGTGTAAAATACTCAATCTCCCCTACTATTCTGTTT
CAGCTAAAATGGGATCCAATCTTAACGAATGTTTTAAAAATATAGCATACAAAGTCTGCA
AATTACCTTTCCCTTCAGAAGAAAAGGTATTAAACATGCAAATATTAAAATAAATTAAAA
TTATTTAATTAAAAATATAGAAAAATGATAAAAGCTTAGAAGGATCTATTCCAGATTTAA
GAAGTGAAGTAAAGGGAAGTAATGGAGACAACAAGACATCAAGTGGATGCAACATATTTT
GA