Identifiers and Description

Gene Model Identifier

TTHERM_00794230

Standard Name

RAB22

Aliases

PreTt21422 | 134.m00102

Description

Rab V family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00794230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13298.12.9986702110910746e-96small GTP-binding protein doma
in-containing protein (374 aa)
WormBaseWBGene000042686.000481660141652e-51locus:rab-5 status:Partially
_confirmed UniProt:P91857
protein_id:CAB04205.1
DictyBaseDDB_G02719841.0002546821282671e-50rab5A on chromosome: 2 positio
n 1113320 to 1114208
SGDYOR089C4.000820122464668e-47VPS21 Rab family GTPase requir
ed for endocytic transport and
for sorting of vacuolar hydro
lases; localized in endocytic
intermediates; detected in mit
ochondria; geranylgeranylation
required for membrane associa
tion; mammalian Rab5 homolog
OxytrichaContig18785.0.g251.9991939848149086e-44Ras family
Stentor CoeruleusSteCoe_55921.2995814250075031e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00794230(coding)
ATGTCAAAAGCAAGAGATATCAAGGTTGTCATTTTAGGTGATGCAGGTGTTGGAAAAACA
AGTATCTTGAATAGATTCTCAAACAAAGGTTTTGATGAAAACTCTTAAACAACTTTGGGA
GCTTCATTTATCCCAAAAGTATTGACCAGGGGTGATAAAACCTACAAATTTTAGATTTGG
GATACTGCCGGTTAAGAAAAATACAGATCATTGGCCCCTCTTTATTATAGAGATACTCAT
GCAGCTTTGATTGTTTATGATATCACCAATAGGGCCTCCTTTGATGTATTAAAAAAATGG
GTTCAAGAACTTAGAGAACATGGTCCTGCTAATATCACCATTGCAGTAGTTGGTAACAAA
GTTGATCTTATTGATAGGGAAGATGTTAAATACGATGAAGCTAAATAGTACGCAAATGAA
TTAAATGCCATCTTTTAATACACAAGTGCTAAGGAAAACCAAAATATTGAGAGTTTATTT
ATTTAAATTGCTGAGAAAGAAGAATAAAAAGATATTAATCCAACAAAGCCATAATCAAAT
AAAGGATTTTAAAATTAGGTTTAAAGACCATAGGGAGGAGGCTGCAATTGTTGA


>TTHERM_00794230(protein)
MSKARDIKVVILGDAGVGKTSILNRFSNKGFDENSQTTLGASFIPKVLTRGDKTYKFQIW
DTAGQEKYRSLAPLYYRDTHAALIVYDITNRASFDVLKKWVQELREHGPANITIAVVGNK
VDLIDREDVKYDEAKQYANELNAIFQYTSAKENQNIESLFIQIAEKEEQKDINPTKPQSN
KGFQNQVQRPQGGGCNC


>TTHERM_00794230(gene)
ATGTCAAAAGCAAGAGATATCAAGGTTGTCATTTTAGGTGATGCAGGTAATTATCATCAA
TTACGACATATTTTTAAATAGCAGGATTAAAAGCTTATAATTAATTTGGAATTATATTGT
CATCATTTTTCATTATTTGATTTTGCACTATTAAATATACACAAATATAAATGTGCAATT
TATAAAAAATAAGTTGAATGAATCTGCTTAATGATTTACTATGTTAAAGTTTATTATGTT
ATTTCTTTAAAAAAGGTGTTGGAAAAACAAGTATCTTGAATAGATTCTCAAACAAAGGTT
TTGATGAAAACTCTTAAACAACTTTGGGAGCTTCATTTATCCCAAAAGTATTGACCAGGG
GTGATAAAACCTACAAATTTTAGGTATTAAATAAATATAATATTTTAGATCTTTAATGAA
AGCACCAATTTTAATTTTACGATTATCAGAATGAAAATTTTTAATCAATAATACTTATTT
CTTTTAGATTTGGGATACTGCCGGTTAAGAAAAATACAGATCATTGGCCCCTCTTTATTA
TAGAGGTAACAATTAATTATTAAGCCAAATAAAAGAATTTGAGTTCTATTTTTTATACAT
TTTAAAGATACTCATGCAGCTTTGATTGTTTATGATATCACCAATAGGGCCTCCTTTGAT
GTATTAAAAAAATGGGTTCAAGAACTTAGAGAACATGGTCCTGCTAATATCAGTAATTTA
TTTATCTATTTTATTTTAGCGAATTCATAAAATTAATTTCTCAAGTACCACAAAGAAAAA
AATATGTCTAATTCATATAATTCATAGATAACTTTGTTTTAAACTCATTTAAAGAGATAA
ATATTTGGAATAGCTTTTTATTAATTAATTTTTGAAAATAATGATATTGGTTTTTAATAA
ATAGCCATTGCAGTAGTTGGTAACAAAGTTGATCTTATTGATAGGGAAGATGTTAAATAC
GATGAAGCTAAATAGTACGCAAATGTAAAAAACCAAATTCTACAATTTATAATAGCTTAT
TGATTTTTTATCAAACATAATATCTATCAATTTAAAAATATTCCCATAAATTATTTAATA
GGAATTAAATGCCATCTTTTAATACACAAGTGCTAAGGAAAACCAAAATATTGAGGTAAA
CAATATTCTAAATAATAATTAGAATATATTCTATAAAACATCAAAAATAAATTTAAGTGA
TTAATACTTTTTTAATTAAAATTATAATAGAGTTTATTTATTTAAATTGCTGAGAAAGAA
GAATAAAAAGATATTAATCCAACAAAGCCATAATCAAATAAAGGATTTTAAAATTAGGTT
TAAAGACCATAGGGAGGAGGCTGCAATTGTTGA