Identifiers and Description

Gene Model Identifier

TTHERM_00540100

Standard Name

RAB21A

Aliases

PreTt12168 | 70.m00164 | 3728.m00061

Description

Rab V family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF00880 ) Nebulin repeat
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR02528 ) ethanolamine utilization protein, EutP
  • ( TIGR00157 ) ribosome small subunit-dependent GTPase A

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.7%

TetraMine Data

TTHERM_00540100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18212.14.99780462713828e-94Ras family protein (588 aa)
OxytrichaContig22470.0.g951.9997255150861791e-53Ras family
DictyBaseDDB_G02865535.001531130907917e-44rab21 on chromosome: 4 positio
n 4804109 to 4805424
WormBaseWBGene000042687.00174216458014e-43locus:rab-5 status:Partially
_confirmed UniProt:P91857
protein_id:CAB04205.1
SGDYOR089C9.99648502569394e-38VPS21 Rab family GTPase requir
ed for endocytic transport and
for sorting of vacuolar hydro
lases; localized in endocytic
intermediates; detected in mit
ochondria; geranylgeranylation
required for membrane associa
tion; mammalian Rab5 homolog
Stentor CoeruleusSteCoe_101891.2995814250075031e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00540100(coding)
ATGAGCAAAGGTACAATGAATAAAATAGTCATTATTGGTGAAGGTAGAGTTGGAAAGACT
TCACTTACATTGAGATATTGCAAAGGAGAATATAGCGATACATAAGAATCTACAATTAAT
GTTTCTTATTTAGAAAAAACAGTCCAAGTAAATGAGACAGATAAAGTTAACATTGCTATT
TGGGATACTGCAGGACAAGAAAAATTCAAATCTATAACTCCTATGTATTACTAGTAAGCT
GTCTGCGCTATTATTGTATATGATATTACTTATAAAGAATCTTTTGATAAGGTTAAATCG
TGGGTTACTGAGCTAACTTAAATTTTAGATACAAATAAGATAGTAATATGTATAGCAGGA
AACAAGTGCGATCTAGAAAATAATAGATAAATTGATAAATAATTTGCAGAAGATTATGCT
AAATCTGTGGGTGCTCGTCATTTCCTTACATCTGCTAAAAACAACAGAGGTATTGATGAA
CTTTTCTAATATGTTGGCTAAGAAATTCTAAAAAGAAATACTAACAAAGGAAAGAAAAAT
AGTAAAATGATTATAAATAATCAATCAATTCTTGAAGGTGATAAAAAGAAAGAAGAAAAA
AAGAAGAAGGACTCTTGCTGTTGA


>TTHERM_00540100(protein)
MSKGTMNKIVIIGEGRVGKTSLTLRYCKGEYSDTQESTINVSYLEKTVQVNETDKVNIAI
WDTAGQEKFKSITPMYYQQAVCAIIVYDITYKESFDKVKSWVTELTQILDTNKIVICIAG
NKCDLENNRQIDKQFAEDYAKSVGARHFLTSAKNNRGIDELFQYVGQEILKRNTNKGKKN
SKMIINNQSILEGDKKKEEKKKKDSCC


>TTHERM_00540100(gene)
ATGAGCAAAGGTACAATGAATAAAATAGTCATTATTGGTGAAGGTAATTATTGCTTTTTA
CTTTTAGAAGATATTCATTAAAATAGTTAAAAACTTTTTTGATATTTCTTGTAAATATTG
AGAAAAAAATATGGATGCTTTTAATCAATCAAACAAAATAATATCTAAAATTGAGAATAT
TTTTATTGGAAAATGTTTAGGTAGAGTTGGAAAGACTTCACTTACATTGAGATATTGCAA
AGGAGAATATAGCGATACATAAGAATCTACAATTAATGTTTCTTATTTAGAAAAAACAGT
CCAAGTAAATGAGACAGATAAAGTTAACATTGCTATTTGGGTAAAAATTATTATTAATAA
TAAAATAGTTTCTGATAAATATTATCTTTAAAATTGCATTATTTTATTTAAAATTTAGTA
TTTGCTAACATAATTTTTTATATAAAAGGATACTGCAGGACAAGAAAAATTCAAATCTAT
AACTCCTATGTATTACTAGTAAGCTGTCTGCGCTATTATTGTATATGATATTACTTATAA
AGAATCTTTTGATAAGGTAAATACAATTAATTATCTTATTTTGAATATATTATACTAATT
TCTCCTATAAAAAAATGATATTTTTCATTCAATTTAGTTTATTTATTTGATCAATTAATG
AAATATAATAGGTTAAATCGTGGGTTACTGAGCTAACTTAAATTTTAGATACAAATAAGA
TAGTAATATGTATAGCAGGAAACAAGTGCGATCTAGAAAATAATAGATAAATTGATAAAT
AATTTGCAGAAGATTATGCTAAATCTGTGGGTGCTCGTCATTTCCTTACATCTGCTAAAA
ACAACAGAGGTATTGATGAACTTTTCTAATATGTTGGCTAAGGTAATAAATAAATAAATA
AATAAATTAATATTATTAAGCTTAATAGTTTGTTGTTTTATAATTTTAATAACATTTTAT
AAAAAAGAAATTCTAAAAAGAAATACTAACAAAGGAAAGAAAAATAGTAAAATGATTATA
AATAATCAATCAATTCTTGAAGGTGATAAAAAGAAAGAAGAAAAAAAGAAGAAGGACTCT
TGCTGTTGA