Identifiers and Description

Gene Model Identifier

TTHERM_00419740

Standard Name

RAB1D

Aliases

PreTt07104 | 46.m00159 | 3679.m00009

Description

Rab I family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF00735 ) Cell division protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( PF03029 ) Conserved hypothetical ATP binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00419740

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11087.14.997910161537908e-106Ras family protein (211 aa)
OxytrichaContig15751.0.0.g876.998463833652622e-61Ras family
WormBaseWBGene000042724.001202823045957e-54locus:rab-8 status:Confirmed
UniProt:G5EFC1 protein_id
:CCD68351.1
SGDYGL210W6.001502944943701e-53YPT32 Rab family GTPase, very
similar to Ypt31p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi
DictyBaseDDB_G02778679.998397555368434e-52rab1B on chromosome: 3 positio
n 743092 to 744234
Stentor CoeruleusSteCoe_256771.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00419740(coding)
ATGTCTCTTTAACAAGATTACGATTATGCATTTAAAATTGCTATTACTGGAAGCTCATCA
GTCGGTAAAAGTTCTTTGATGATGAGATTTACAGACGATGTATTTAATGTAGTACTCATT
CCTACTATTGGCGTTGACTTTAAAATTCGTTCATTTACTGTAGACAACAAAATAGTAAAG
CTTAATATTTGGGATACAGCTGGTTAAGAAAGATTTGATGCTATAATTAAGGCTTATTAC
AAGGGAATACATGCATGTTTAATTGTATTTGATTTAACAGATCGTCAAACATTCCAAGAT
GTTTATAAGTGGTTTGATAAGTGTAAACAAAATGCCAAAAATGAAGTTAAATTAATTTTA
GTAGGTAATAAAGCTGATCTGGAAGAATAAAGAGCAGTGACTTATGAAGAAGCATGTAAT
CTCGCTTAGGAACTAGATATGTAATATATTGAAACTTCTGCTAAATCAAAATAAAATGTA
GATCAATGCTTTATTTAATTGAGTCAAGACCTCATTTAGTAATATATAAAATAAAACAAA
TAAATTTAATTTGAAACATAAAAATAAAAATCTCATCTTAAGCCTGGTGGTGCTACTATT
TAAAAATAATAATAAAAATCAGCATAATGCTGCTGA


>TTHERM_00419740(protein)
MSLQQDYDYAFKIAITGSSSVGKSSLMMRFTDDVFNVVLIPTIGVDFKIRSFTVDNKIVK
LNIWDTAGQERFDAIIKAYYKGIHACLIVFDLTDRQTFQDVYKWFDKCKQNAKNEVKLIL
VGNKADLEEQRAVTYEEACNLAQELDMQYIETSAKSKQNVDQCFIQLSQDLIQQYIKQNK
QIQFETQKQKSHLKPGGATIQKQQQKSAQCC


>TTHERM_00419740(gene)
ATGTCTCTTTAACAAGATTACGATTATGCATTTAAAATTGCTATTACTGGAAGCTCATCA
GTCGGTAAAAGTTCTTTGATGATGAGATTTACAGACGATGTATTTAATGTAGTACTCATT
CCTACTATTGGCGTTGACTTTAAAATTCGTTCATTTACTGTAGACAACAAAATAGTAAAG
CTTAATATTTGGGATACAGCTGGTTAAGAAAGATTTGATGCTATAATTAAGGCTTATTAC
AAGGGAATACATGCATGTTTAATTGTATTTGATTTAACAGATCGTCAAACATTCCAAGAT
GTTTATAAGTGGTTTGATAAGTGTAAACAAAATGCCAAAAATGAAGTTAAATTAATTTTA
GTAGGTAATAAAGCTGATCTGGAAGAATAAAGAGCAGTGACTTATGAAGAAGCATGTAAT
CTCGCTTAGGAACTAGATATGTAATATATTGAAACTTCTGCTAAATCAAAATAAAATGTA
GATCAATGCTTTATTTAATTGAGTCAAGACCTCATTTAGTAATATATAAAATAAAACAAA
TAAATTTAATTTGAAACATAAAAATAAAAATCTCATCTTAAGCCTGGTGGTGCTACTATT
TAAAAATAATAATAAAAATCAGCATAATGCTGCTGA