Identifiers and Description

Gene Model Identifier

TTHERM_00957580

Standard Name

RAB17A

Aliases

PreTt21654 | 177.m00058

Description

Rab V family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR02528 ) ethanolamine utilization protein, EutP

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00957580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14072.19.999664388307901e-124Ras family protein (199 aa)
OxytrichaContig22448.0.g391.0000633497921574e-36Ras family
SGDYOR089C3.00033207980219e-32VPS21 Rab family GTPase requir
ed for endocytic transport and
for sorting of vacuolar hydro
lases; localized in endocytic
intermediates; detected in mit
ochondria; geranylgeranylation
required for membrane associa
tion; mammalian Rab5 homolog
DictyBaseDDB_G02898273.999374135750469e-31rab18 on chromosome: 5 positio
n 3292859 to 3293559
WormBaseWBGene000042863.0010664139725277e-29locus:rab-39 status:Partiall
y_confirmed UniProt:Q18969
protein_id:CAA87774.2
Stentor CoeruleusSteCoe_99872.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00957580(coding)
ATGTGTTTCGGATCCAGCTCTAAGAAATAGTAAAGCAAACCCAAGCTTTTAAAGCCCAAG
CAAAGTTAGTACAAAACTAAGCTCATTCTTTTAGGTGACATGAACGTAGGCAAAACTTCA
ATCTGCGAGTATTACAAGAAGAACGTGCCTGCAAAGAACTTGCCAAATACAATTGGTGTC
ACATATTTCGAGTTCGACATCAAACTAGAAAATGGCATTAACGTTCACTTAGATATTTGG
GATACAGCAGGATAAGAAATTTATTAGTCACTACTAAAGATATACTATCAAGATGCTAAC
ATAGTTTTTTTAGTTTTTGATGTGAGTGCAAGATAGACTCTTGAACGTGTTGAGTACTGG
ATTAGCGAACTCAAAGAGCAAGTAGATGATAAAAACCTAAAGTTGGTGTTAATAGGTAAC
AAATGCGACATAGATGCAGATAAGAGGTAAATCAGTCTTGAGCAAGGTCAAGATTTTGCT
AGAAATAAAAACATTCCTTACTTTGAAACTAGTGCAATCACTGGAGAAGGAATAGTTGAA
GTATTCCGCTAAACAGTAAAGGACTATGTGTAATATAAGACAAACGGAGGAAAATGA


>TTHERM_00957580(protein)
MCFGSSSKKQQSKPKLLKPKQSQYKTKLILLGDMNVGKTSICEYYKKNVPAKNLPNTIGV
TYFEFDIKLENGINVHLDIWDTAGQEIYQSLLKIYYQDANIVFLVFDVSARQTLERVEYW
ISELKEQVDDKNLKLVLIGNKCDIDADKRQISLEQGQDFARNKNIPYFETSAITGEGIVE
VFRQTVKDYVQYKTNGGK


>TTHERM_00957580(gene)
ATGTGTTTCGGATCCAGCTCTAAGAAATAGTAAAGCAAACCCAAGCTTTTAAAGCCCAAG
CAAAGTTAGTACAAAACTAAGCTCATTCTTTTAGGTGACATGAACGTAGGCAAAACTTCA
ATCTGCGAGTATTACAAGAAGAACGTGCCTGCAAAGAACTTGCCAAATACAATTGGTGTC
ACATATTTCGAGTTCGACATCAAACTAGAAAATGGCATTAACGTTCACTTAGATATTTGG
GATACAGCAGGATAAGAAATTTATTAGTAAGCCTTTATTTTTTTAGCAATAAGAAGATTC
TTCCCATTTGAATTCTCATTTGACTCGTTCCAATTGAGTTCTGAGTTCTTTCGTTTTTTT
AATATTTTTGTTAACTTTCTTAGAGATTGTCCAGCTAGCTATTCATTCATTTGCATAATA
AATGTTATTAAAGCCAAAAAATAAAATAAAAGCAAAGATAAGAAAAGAAGAACTTGATTT
GGGCAGATTAAATATGTGTTGAATTTATAATGAATTAAATTAAGGTATTTTATTTTGTAA
TATCAATGAATAGGTCACTACTAAAGATATACTATCAAGATGCTAACATAGTTTTTTTAG
TTTTTGATGTGAGTGCAAGATAGACTCTTGAACGTGTTGAGTACTGGATTAGCGAACTCA
AAGAGCAAGTAGATGATAAAAACCTAAAGTTGGTGTTAATAGGTAACAAATGCGACATAG
ATGCAGATAAGAGGTAAATCAGTCTTGAGCAAGGTCAAGATTTTGCTAGAAATAAAAACA
TTCCTTACTTTGAAACTAGTGCAATCACTGGAGAAGGAATAGTTGAAGTATTCCGCTAAA
CAGTAAAGGACTATGTGTAATATAAGACAAACGGAGGAAAATGA