Identifiers and Description

Gene Model Identifier

TTHERM_00471070

Standard Name

RAB11D (RAB GTPase 11D)

Aliases

PreTt22521 | 56.m00225 | 3686.m00068

Description

Rab II family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00471070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11333.12.0006597401342834e-129Ras family protein (226 aa)
OxytrichaContig16926.0.g711.0002758036576784e-62Ras family
SGDYER031C7.997312755134699e-60YPT31 Rab family GTPase, very
similar to Ypt32p; involved in
the exocytic pathway; mediate
s intra-Golgi traffic or the b
udding of post-Golgi vesicles
from the trans-Golgi
WormBaseWBGene000042742.9997246065828143e-59locus:rab-11.1 status:Confir
med UniProt:O01803 protein
_id:CCD71701.1
DictyBaseDDB_G02692382.0004062814618821e-57rab11A on chromosome: 1 positi
on 4269122 to 4270264
Stentor CoeruleusSteCoe_273261.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00471070(coding)
ATGGCTTCGTTATCGTTAAAAGAAACTGAAGTGTAACTAGATTACTAGTTTAAAATATTA
TTGATAGGTGACAGTGGAGTAGGAAAAACTTCAATTATGAATAGATTCACTGAAAATAAA
TTTAATGTTGAAATAAAATCAACAATAGGAGTTGAATATAGTAAAAAAACTATGGTTATT
GATTAAGCTGTTATTTAAGCCTCTATTTGGGATACTGCCGGATAAGAAAGATTTAGATCT
TTAGCTAAAAATTATTACAAAGGTGCTATAGGTGCTTTATTAGTTTTTGATGTTACAAGA
CCACATACTCTCGAAAATATTTAAAAGATATGGCTCTAAGAAGTCGAATAGCATGCATCA
AAAAATATTAAAATGATTTTAATTGGAAACAAGAGCGATTTAACTGTAGAGCGTATTGTA
AAATAGGAAGAAGCAGTTAATTTCTCCAAAACAAATAACCTAGCTTATATGGAAACATCT
GCATTAAACAATTAAAATATTGATTAGGCATTTGAGACTCTCGTAAGAGAAATATACAGT
GAAATCAATTCACTCCCTTCTGAAATCCGTCCTAAAAACTTAACATAGCGTAAAGAGCAT
ACTCCCTAAGTTAATTAAAACAATAACTTACAGATTGACAAGAAAAATATTAAAAAGAAA
AGAGCATGTTGTGAATGA


>TTHERM_00471070(protein)
MASLSLKETEVQLDYQFKILLIGDSGVGKTSIMNRFTENKFNVEIKSTIGVEYSKKTMVI
DQAVIQASIWDTAGQERFRSLAKNYYKGAIGALLVFDVTRPHTLENIQKIWLQEVEQHAS
KNIKMILIGNKSDLTVERIVKQEEAVNFSKTNNLAYMETSALNNQNIDQAFETLVREIYS
EINSLPSEIRPKNLTQRKEHTPQVNQNNNLQIDKKNIKKKRACCE


>TTHERM_00471070(gene)
ATGGCTTCGTTATCGTTAAAAGAAACTGAAGTGTAACTAGATTACTAGTTTAAAATATTA
TTGATAGGTGACAGTGGAGTAGGAAAAACTTCAATTATGAATAGATTCACTGAAAATAAA
TTTAATGTTGAAATAAAATCAACAATAGGAGTTGAATATAGTAAAAAAACTATGGTTATT
GATTAAGCTGTTATTTAAGCCTCTATTTGGGATACTGCCGGATAAGAAAGATTTAGATCT
TTAGCTAAAAATTATTACAAAGGTGCTATAGGTGCTTTATTAGTTTTTGATGTTACAAGA
CCACATACTCTCGAAAATATTTAAAAGATATGGCTCTAAGAAGTCGAATAGCATGCATCA
AAAAATATTAAAATGATTTTAATTGGAAACAAGAGCGATTTAACTGTAGAGCGTATTGTA
AAATAGGAAGAAGCAGTTAATTTCTCCAAAACAAATAACCTAGCTTATATGGAAACATCT
GCATTAAACAATTAAAATATTGATTAGGCATTTGAGACTCTCGTAAGAGGTAAATTTTAC
TTTCAAAATAAAATATCTCTTATAAAAAAAGCAGGAAAAAAAATATATTTTAAGTTAATT
GTATTTATTTTCTTAAATTATAATGTTAGCTTTGAAAAATAAATGATTTTATAATTTTAT
CTCCTTTTTATAAGAAAATTATCTAAACTTACAAGCTATTAAAAATATTAATTCATCATA
AACTCTTTCAAAACAAACAAACATACAAAATAAAATATTATTATTATTTTTAAAAATAGA
AATATACAGTGAAATCAATTCACTCCCTTCTGAAATCCGTCCTAAAAACTTAACATAGCG
TAAAGAGCATACTCCCTAAGTTAATTAAAACAATAACTTACAGATTGACAAGAAAAATAT
TAAAAAGAAAAGAGCATGTTGTGAATGA