Identifiers and Description

Gene Model Identifier

TTHERM_00347990

Standard Name

RAB11C

Aliases

PreTt05211 | 36.m00175 | 3703.m00008

Description

Rab II family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00071 ) Ras family
  • ( PF08477 ) Miro-like protein
  • ( PF01926 ) GTPase of unknown function
  • ( PF00025 ) ADP-ribosylation factor family
  • ( PF00027 ) cyclic nucleotide-binding domain
  • ( TIGR00231 ) small GTP-binding protein domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00347990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09718.19.997217559668329e-127hypothetical protein (851 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00347990(coding)
ATGAGTAATGTGAAAATATCTTCAATAAATGAAAATTAAAATATACAAATGAAGCTTGCA
GGGCTAAAAGATTTGCTTAAAACATAAGTAGAAAATAGAAACTAAGAGTAGATCAGCAAA
ATTTCTAGCATTATTAAATAATTATCTGTTCTTCCGAACTACTTTTCATCTTAAAATGTA
TTGGGATACTAAATAGGCAATTATCAAGATAAAATAGATTATTTTATAGCTTCATAGCTA
GAATACTTGGTATTCGATTCAAATATTGACATTCAAAATAAAATAAGAGACGATAAAGGG
ATTTGCCTTTTACTATCTGGAAAAATAACGCTTGAAAAGATTATATAAAATGAAAATATT
CAAAATAAAAGTATTGATAAAAGTATAGTAGTATTAAAAGAGTTTAAAAAGGGTAGCTTT
TTCAGCTTTTACGATATTCAGTATTAAGTAGAAGGTTCAAAAATTACAATTTCAGGTCAA
AACGATTTAATGAATGTCCTGGGAGAAAGTGAATAGAAACAAAAATTTGACAATATAGAA
GTTGGCTATTTAAATTTATAGTTGTAGAAAGAGATAAAAAGTTAATTACAAACAGCAAAT
TATAAATCATCTATATTTAATTATTATGATAGCATTATAAAGAAAGAAATATCATTAATG
AAATTAAATTATGGTTTTACACAATATCTCTCAGAGATCTAGATAGGATAAATTCTTTTT
CATTCTTAAATTAGAAATTTTTCAAATAAAGAACCTGTGTTTCTAAATAAAGAAGAATCT
AATTATGTCTATATTGTTAGAAAAGGAAGTTTTTAAGTTTTTTGGAGAGACTATTCTATA
AATTAGTAAAGATAATCTATATTCTTTTCAAACTTAGACTAAGAAAATTCCCTGCTTAGA
AGATGGTCTTTGAGAGTTTATGAATCTAAGGAAATATTTGGTGAAGATGATATTATTTTT
AATTGCAGATAAAGATGCTTTGATGTTATATGTAATAGTGTGTCAGGCCAACTTATAACA
ATACAAAAAAACTATTTTCTTTATTGCTTATATCCTATGCTGAAGAATTACTTTAATGTT
TTGGTTGAGGATAAAGAAAAGCTCATTAATGAAAGAATTAATTAAATTAGAAATTAATAA
GGCAAAAACTTTACTATTGTCTCTCCATCTTTATAATCTACACAACCCATATCAAGAGAA
TGTAAGGAAATTTCCTTAGAAGATAGCTATAATAGTGTGCAGTTTATATAAAAGTAGTAA
TCATTATCATCTCCTTCTGTTTCTCCTGATAATTTTTGTACTAATGTTAGTTAAAAAGAA
AAAAAAGATGCTTTAATATTACAATAAGGACTCTCAAGTCAGCTCACTCAACAAAATTCA
AAATAAGAAAGCTAAAAAAGCAATTTAGAACATAAAAATTCAAATAAAATGCTTTTTTAG
TTTATTTTAAATAAATCAAATTATGCTCAAAATTAACCATAATAAATGAACAAAAAAATT
AATAACAGTATTTAAGCAAGATTAAATACAAAAAGATATGATAATATAGGTAATGTAAAC
AGGTTAGAACAAAATATTATAGAAAATAAATAAATAGAAGTTAGCTAAAGCAATAATTTA
AATTAAAAAGTTTAAAAGTTATTACAATAAAATTTAACAAATTCTTTATCCTTTACTTAA
AAGGAGGAGTTTGAATAATCATTTTAAAACTCCCTTAACAAATTAATTGAATATCAAGTC
TCTTAAACTTTTTCTTCTCGCTCAATAAAAAATAACAGTCATACATTCAACAACCCTAAA
TCAGAAACAGCTATTGGAATAAAAAAGAGATAAAAAAATTTAATTTCTGAACCCTCTTTT
TCGTTTTAGTAGATATCACCTTCACTTAAAGACTCGAATTCATTAATAGCTAAACAAAAA
AAATTAAAAACTAATAATTTTTAGTATTCTTAATCGCCAAACAAAAATTCTTTACAAAAC
TTTTCAGAGATTAATTTTCCTTAAACTTCAGAGAGAAGAACAATAAAAAAAAATAATAGT
TAAAATGCAGTTTTAAAGAGATAAGCAAACAGAGTTAGCCCGATTTAATCGGACAAAGCA
ATAGTCTTAAAAAGTAGCAGCGAAAGTGCAAGTTAAGGAACTAATAATTCTGAAGGAGTT
TGTATTTTGCAGGCTCTCCAAGCATCAAATAGTGCAAATTTAACTAACACTAATAATAGT
CATAGTACATAAAATAATAAAAGTATAAATTAAAAATTAATTTTAAACAGCAACAATAGC
AGTAGTATTTCAGTTTAAAGTGCAAAAATATCTAATGGCATATATTTGAATTAAAGCTCA
GGAGTCATTTAAGAAGAAAATTAATAAACTTTTTAAAAATTTCATAGCTTTAAATAAGAA
ATGCTTGAAAAGCTAAAGGAAAATCACAATTTAAAATCTAAAAAAGAAATTTTATCTAAA
AGTTTATCTTAAAAATAGCAATAATAATAGTAGACATAATCTCTTTCATGCTATAGCAAT
ATGATATACAGTAAAATCAAAGAAAAAGATAGCATAAGAAAAAATTTGAAAAAGGAATAT
TCTGTTTTAAATAAAAAGGGTAATATTAATGCGCTCTCACAATATTCTTTTAAACTTGGA
AATTATAAAATTAAAAGTGAGCTATTGTCAAACTCTTTTGAAAACTTAAAATAAATATCT
ACTTCAAACCAAGAAAAAATAAATAAGTTAAGAAGAAAGTTTTCTGGAGAAGAAAATATG
AATAGTAATAAACCAAAATATTTATTTACTCCTTCAAGCGTTTCTCATAGTAAATTTAGT
AAAAAAAGTAAAGGTTAATAGCTTTTAGAAAAAATAGTAGGAGGAAGCTAGTTAAACAAC
AAGTTAGAATATTAAAATTTATTTTTGAATTCTCCACTTTAATAAGATGTTAAAAGTTTA
CTTGAAAAATAGTAGTCATAAATGTTTGGAATAGACAAAATTCTAACTGAGCAGAGCTAA
AAACCTTCTATTACTTAAAGGGCTACCTAGTATATTACTAATGAATTGAAATTTTTTAAC
AATGATACTTAAAACAGCTCGCAAGCTCACATTTAAACTGATACTTCCCCTTAAACACAG
GATCGTCTTAAATAAATTAATGAAACACCATAAACAGCTTCAAAAACTCCAATAAATACG
AATCTTGATAAAGAATCAGATAAAACAGCAAAAAGCAATTAAAATAACTCTTAAAAGTTC
AACAATATACATTCGAACTAGTAGTCTTCTAGTTATCATTTACTCTAACAAATCACTAAA
TATCAACATTTTAACTAAAATATAAAATAAATTAATAATAAAAATTTTGGAAAATTAAAG
TAGCTAATTAGTTAAAGCTTTGCTACTCCAAAATGCAAGAATATATCTTCTTAAAAAATT
TAATAAACATGTATCGGAGAAACGCCTAAAAATCTTAGTATATAAAATGATTAAAGTATA
ACTTAACAGCAATAAAATTGA


>TTHERM_00347990(protein)
MSNVKISSINENQNIQMKLAGLKDLLKTQVENRNQEQISKISSIIKQLSVLPNYFSSQNV
LGYQIGNYQDKIDYFIASQLEYLVFDSNIDIQNKIRDDKGICLLLSGKITLEKIIQNENI
QNKSIDKSIVVLKEFKKGSFFSFYDIQYQVEGSKITISGQNDLMNVLGESEQKQKFDNIE
VGYLNLQLQKEIKSQLQTANYKSSIFNYYDSIIKKEISLMKLNYGFTQYLSEIQIGQILF
HSQIRNFSNKEPVFLNKEESNYVYIVRKGSFQVFWRDYSINQQRQSIFFSNLDQENSLLR
RWSLRVYESKEIFGEDDIIFNCRQRCFDVICNSVSGQLITIQKNYFLYCLYPMLKNYFNV
LVEDKEKLINERINQIRNQQGKNFTIVSPSLQSTQPISRECKEISLEDSYNSVQFIQKQQ
SLSSPSVSPDNFCTNVSQKEKKDALILQQGLSSQLTQQNSKQESQKSNLEHKNSNKMLFQ
FILNKSNYAQNQPQQMNKKINNSIQARLNTKRYDNIGNVNRLEQNIIENKQIEVSQSNNL
NQKVQKLLQQNLTNSLSFTQKEEFEQSFQNSLNKLIEYQVSQTFSSRSIKNNSHTFNNPK
SETAIGIKKRQKNLISEPSFSFQQISPSLKDSNSLIAKQKKLKTNNFQYSQSPNKNSLQN
FSEINFPQTSERRTIKKNNSQNAVLKRQANRVSPIQSDKAIVLKSSSESASQGTNNSEGV
CILQALQASNSANLTNTNNSHSTQNNKSINQKLILNSNNSSSISVQSAKISNGIYLNQSS
GVIQEENQQTFQKFHSFKQEMLEKLKENHNLKSKKEILSKSLSQKQQQQQQTQSLSCYSN
MIYSKIKEKDSIRKNLKKEYSVLNKKGNINALSQYSFKLGNYKIKSELLSNSFENLKQIS
TSNQEKINKLRRKFSGEENMNSNKPKYLFTPSSVSHSKFSKKSKGQQLLEKIVGGSQLNN
KLEYQNLFLNSPLQQDVKSLLEKQQSQMFGIDKILTEQSQKPSITQRATQYITNELKFFN
NDTQNSSQAHIQTDTSPQTQDRLKQINETPQTASKTPINTNLDKESDKTAKSNQNNSQKF
NNIHSNQQSSSYHLLQQITKYQHFNQNIKQINNKNFGKLKQLISQSFATPKCKNISSQKI
QQTCIGETPKNLSIQNDQSITQQQQN


>TTHERM_00347990(gene)
AACAAATAACATAGATAAATTTGCAATTTTTAAACTTTAACATAAATATAAATGAGTAAT
GTGAAAATATCTTCAATAAATGAAAATTAAAATATACAAATGAAGCTTGCAGGGGTAAGA
TCTTTTCAATATGGCTAATTCAGCATTTTTTTTATAAATGTCAATTCTTTATACAGTTTA
TACTTATTTTTTGTTTTTTAGCTAAAAGATTTGCTTAAAACATAAGTAGAAAATAGAAAC
TAAGAGTAGATCAGCAAAATTTCTAGCATTATTAAATAATTATCTGTTCTTCCGAACTAC
TTTTCATCTTAAAATGTATTGGGATACTAAATAGGCAATTATCAAGATAAAATAGATTAT
TTTATAGCTTCATAGCTAGAATACTTGGTATTCGATTCAAATATTGACATTCAAAATAAA
AGTATTTCGATAGCAATATTTCTTTTCTTTAATTAAATATGGATTTTTTTAAAAATATTT
CAAAATATAAACCTAAGACACTAAATTTTTTTTTCTTTGTATTAGTAAGAGACGATAAAG
GGATTTGCCTTTTACTATCTGGAAAAATAACGCTTGAAAAGATTATATAAAATGAAAATA
TTCAAAATAAAAGTATTGATAAAAGTATAGTAGTATTAAAAGAGTTTAAAAAGGGTAGCT
TTTTCAGCTTTTACGATATTCAGTATTAAGTAGAAGGTTCAAAAATTACAATTTCAGGTC
AAAACGATTTAATGAATGTCCTGGGAGAAAGTGAATAGAAACAAAAATTTGACAATATAG
AAGTTGGCTATTTAAATTTATAGTTGTAGAAAGAGATAAAAAGTTAATTACAAACAGCAA
ATTATAAATCATCTATATTTAATTATTATGATAGCATTATAAAGAAAGAAATATCATTAA
TGAAATTAAATTATGGTTTTACACAATATCTCTCAGAGATCTAGATAGGATAAATTCTTT
TTCATTCTTAAATTAGAAATTTTTCAAATAAAGAACCTGTGTTTCTAAATAAAGAAGAAT
CTAATTATGTCTATATTGTTAGAAAAGGAAGTTTTTAAGTAATTAATTATTTTTTAGAGT
CGTTTTACTTGTATTAAAAATAATCTATTATAATAATTCTATGATTTAAATATTTGTTAG
ATCTAATTTATTTTTTAAATTTTAATTTTTAAAAAATATTTTAAAATATAAATAAAATTA
TAGGTTTTTTGGAGAGACTATTCTATAAATTAGTAAAGATAATCTATATTCTTTTCAAAC
TTAGACTAAGAAAATTCCCTGCTTAGAAGATGGTCTTTGAGAGTTTATGAATCTAAGGAA
ATATTTGGTGAAGATGATATTATTTTTAATTGCAGATAAAGATGCTTTGATGTTATATGT
AATAGTGTGTCAGGCCAACTTATAACAATACAAAAAAACTATTTTCTTTATTGCTTATAT
CCTATGCTGAAGAATTACTTTAATGTTTTGGTTGAGGATAAAGAAAAGCTCATTAATGAA
AGAATTAATTAAATTAGAAATTAATAAGGCAAAAACTTTACTATTGTCTCTCCATCTTTA
TAATCTACACAACCCATATCAAGAGAATGTAAGGAAATTTCCTTAGAAGATAGCTATAAT
AGTGTGCAGTTTATATAAAAGTAGTAATCATTATCATCTCCTTCTGTTTCTCCTGATAAT
TTTTGTACTAATGTTAGTTAAAAAGAAAAAAAAGATGCTTTAATATTACAATAAGGACTC
TCAAGTCAGCTCACTCAACAAAATTCAAAATAAGAAAGCTAAAAAAGCAATTTAGAACAT
AAAAATTCAAATAAAATGCTTTTTTAGTTTATTTTAAATAAATCAAATTATGCTCAAAAT
TAACCATAATAAATGAACAAAAAAATTAATAACAGTATTTAAGCAAGATTAAATACAAAA
AGATATGATAATATAGGTAATGTAAACAGGTTAGAACAAAATATTATAGAAAATAAATAA
ATAGAAGTTAGCTAAAGCAATAATTTAAATTAAAAAGTTTAAAAGTTATTACAATAAAAT
TTAACAAATTCTTTATCCTTTACTTAAAAGGAGGAGTTTGAATAATCATTTTAAAACTCC
CTTAACAAATTAATTGAATATCAAGTCTCTTAAACTTTTTCTTCTCGCTCAATAAAAAAT
AACAGTCATACATTCAACAACCCTAAATCAGAAACAGCTATTGGAATAAAAAAGAGATAA
AAAAATTTAATTTCTGAACCCTCTTTTTCGTTTTAGTAGATATCACCTTCACTTAAAGAC
TCGAATTCATTAATAGCTAAACAAAAAAAATTAAAAACTAATAATTTTTAGTATTCTTAA
TCGCCAAACAAAAATTCTTTACAAAACTTTTCAGAGATTAATTTTCCTTAAACTTCAGAG
AGAAGAACAATAAAAAAAAATAATAGTTAAAATGCAGTTTTAAAGAGATAAGCAAACAGA
GTTAGCCCGATTTAATCGGACAAAGCAATAGTCTTAAAAAGTAGCAGCGAAAGTGCAAGT
TAAGGAACTAATAATTCTGAAGGAGTTTGTATTTTGCAGGCTCTCCAAGCATCAAATAGT
GCAAATTTAACTAACACTAATAATAGTCATAGTACATAAAATAATAAAAGTATAAATTAA
AAATTAATTTTAAACAGCAACAATAGCAGTAGTATTTCAGTTTAAAGTGCAAAAATATCT
AATGGCATATATTTGAATTAAAGCTCAGGAGTCATTTAAGAAGAAAATTAATAAACTTTT
TAAAAATTTCATAGCTTTAAATAAGAAATGCTTGAAAAGCTAAAGGAAAATCACAATTTA
AAATCTAAAAAAGAAATTTTATCTAAAAGTTTATCTTAAAAATAGCAATAATAATAGTAG
ACATAATCTCTTTCATGCTATAGCAATATGATATACAGTAAAATCAAAGAAAAAGATAGC
ATAAGAAAAAATTTGAAAAAGGAATATTCTGTTTTAAATAAAAAGGGTAATATTAATGCG
CTCTCACAATATTCTTTTAAACTTGGAAATTATAAAATTAAAAGTGAGCTATTGTCAAAC
TCTTTTGAAAACTTAAAATAAATATCTACTTCAAACCAAGAAAAAATAAATAAGTTAAGA
AGAAAGTTTTCTGGAGAAGAAAATATGAATAGTAATAAACCAAAATATTTATTTACTCCT
TCAAGCGTTTCTCATAGTAAATTTAGTAAAAAAAGTAAAGGTTAATAGCTTTTAGAAAAA
ATAGTAGGAGGAAGCTAGTTAAACAACAAGTTAGAATATTAAAATTTATTTTTGAATTCT
CCACTTTAATAAGATGTTAAAAGTTTACTTGAAAAATAGTAGTCATAAATGTTTGGAATA
GACAAAATTCTAACTGAGCAGAGCTAAAAACCTTCTATTACTTAAAGGGCTACCTAGTAT
ATTACTAATGAATTGAAATTTTTTAACAATGATACTTAAAACAGCTCGCAAGCTCACATT
TAAACTGATACTTCCCCTTAAACACAGGATCGTCTTAAATAAATTAATGAAACACCATAA
ACAGCTTCAAAAACTCCAATAAATACGAATCTTGATAAAGAATCAGATAAAACAGCAAAA
AGCAATTAAAATAACTCTTAAAAGTTCAACAATATACATTCGAACTAGTAGTCTTCTAGT
TATCATTTACTCTAACAAATCACTAAATATCAACATTTTAACTAAAATATAAAATAAATT
AATAATAAAAATTTTGGAAAATTAAAGTAGCTAATTAGTTAAAGCTTTGCTACTCCAAAA
TGCAAGAATATATCTTCTTAAAAAATTTAATAAACATGTATCGGAGAAACGCCTAAAAAT
CTTAGTATATAAAATGATTAAAGTATAACTTAACAGCAATAAAATTGA