Identifiers and Description

Gene Model Identifier

TTHERM_00773650

Standard Name

PZN1

Aliases

PreTt04456 | 128.m00134 | 3676.m00059

Description

Poly polymerase and DNA-Ligase Zn-finger region family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF08063 ) PADR1 (NUC008) domain
  • ( PF00645 ) Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.6%

TetraMine Data

TTHERM_00773650

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07117.11.000434858898539e-105hypothetical protein (232 aa)
DictyBaseDDB_G02918720.000050024383570459175DDB_G0291872 on chromosome: 6
position 855161 to 857960

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00773650(coding)
ATGACAACTAATTTTACTAATTTTTACTACGACTGCTTTTGTGCTGAACTAGCTAAAAGT
GGTAGATCTTAATGTAAAGCATGCTATAATCCTATTGAAAATGATAGCCTAAGAATTGGA
TATAAAATTTATGTTAACGAAGAGCATTCTGTAATAAGTACTAAATGGTATCACCCTAAA
TGTGTAGTTCTACCAGAAAAATTTACAAACTTAAAGGTATGGGATATTGAGGGAATAGAC
GACTTAGAGTCTAAATATCACAAAGAAATAAAAGAATCACTTAAAATCTAATAAGGAAAA
AAAGATTAAAGAGTCTAACATCTCCCAAAAATAACAATTAGAGAGTGTAAACCTACTTCA
AAATTTAACTAATAAAAAACATTCGATAAGCAGTAATGGAATAAGTTTGTTTCTTATAAG
GAAGAGTTTAATAATATGGATTATAAATAACTAAAGTAGTTGTTGATTAAAAATGACTCC
TGCACTTTTGGTGGTAAAAAGTTACTTGCTAAAAGATGTGCTATACTGAAGATGATTGGG
GTTGTGAAACACTGTCCAACATGCGGAGGTAATAGGATAAGATTTTATTTTGCTGATGGC
TAATATTATTGTCCAGGTTATCTAGATGATACTAATTGGGTAGACTGCAAACAATGGTTT
GATGTAGATGAAATTAAAGGATACGATTGGATAGAGTGA


>TTHERM_00773650(protein)
MTTNFTNFYYDCFCAELAKSGRSQCKACYNPIENDSLRIGYKIYVNEEHSVISTKWYHPK
CVVLPEKFTNLKVWDIEGIDDLESKYHKEIKESLKIQQGKKDQRVQHLPKITIRECKPTS
KFNQQKTFDKQQWNKFVSYKEEFNNMDYKQLKQLLIKNDSCTFGGKKLLAKRCAILKMIG
VVKHCPTCGGNRIRFYFADGQYYCPGYLDDTNWVDCKQWFDVDEIKGYDWIE


>TTHERM_00773650(gene)
ATGACAACTAATTTTACTAATTTTTACTACGACTGCTTTTGTGCTGAACTAGCTAAAAGT
GGTAGATCTTAATGTAAAGCATGCTATAATCCTATTGAAAATGATAGCCTAAGAATTGGA
TATAAAATTTATGTTAACGAAGAGCATTCTGTAATAAGTACTAAATGGTATCACCCTAAA
TGTGTAGTTCTACCAGAAAAATTTACAAACTTAAAGGTATGGGATATTGAGGGAATAGAC
GACTTAGAGTCTAAATATCACAAAGAAATAAAAGAATCACTTAAAATCTAATAAGGAAAA
AAAGATTAAAGAGTCTAACATCTCCCAAAAATAACAATTAGAGAGTGTAAACCTACTTCA
AAATTTAACTAATAAAAAACATTCGATAAGCAGTAATGGAATAAGTTTGTTTCTTATAAG
GAAGAGTTTAATAATATGGATTATAAATAACTAAAGTAGTTGTTGATTAAAAATGACTCC
TGCACTTTTGGTGGTAAAAAGTTACTTGCTAAAAGATGTGCTATACTGAAGATGATTGGG
GTTGTGAAACACTGTCCAACATGCGGAGGTAATAGGATAAGATTTTATTTTGCTGATGGC
TAATATTATTGTCCAGGTTATCTAGATGATACTAATTGGGTAGACTGCAAACAATGGTTT
GATGTAGATGAAATTAAAGGATACGATTGGATAGAGTGA