Identifiers and Description

Gene Model Identifier

TTHERM_00071060

Standard Name

PZFL-1 (PHD Zinc Finger Like protein 1)

Aliases

PreTt13296 | 4.m00695 | 3707.m00330

Description

PHD-zinc-finger-like domain protein; Primarily localizes to daughter macronucleus during conjugation; solely expressed during conjugation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 20.8%

TetraMine Data

TTHERM_00071060

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02216.15.001363273675253e-167hypothetical protein (1200 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000373

Sequences

>TTHERM_00071060(coding)
ATGTTATTAATTAATTTTGAAAATATAATGATGTCTTTTCTTTAAAATTTATTAAATTAA
TTAAATTCATAAAATCATTCTAATAAAATGACAAGGAGTGTTTATAAAAAATTACCCTCA
AAAAATTAGAAAGTAAATAAAAATAAAAAAGAGAACGTTGTTGTTATATAAGCTAAATAA
TTAACTTCGTCTTCAAGAATTAACACTCAAAAGAAGTAAAATAAGACCAAGTACATTACT
AAGAAAAATAAAAAAGTCACACCTAGGCAGAAAATTAGCAAAATCTCTCAAAATTAGCCT
ACTAGCTAAGATTAACCGTCAAATATATAAAACAAATATAATTTTAAAGATATTTAAAGA
AAAATGCTTTACAGAAAAATATAATAAAATGATAGTATTTTAAAAAGCAAACCTTATTTT
AACTACTTCCATTGCAAAGATTATGAAAAAGATCCCAGAAAGTGTGACAACTGCTTTGAT
AGTTAAATAACAGAAGAAAATGAAATGCTTTATTGTGAAGAATGCAATTCCTTTTTACAT
AAGCTTTGTTATAGTGTGTCTTAAGACTAGTTTGATCTTATAAATAAATAAGAAACCGAA
GATGAGTGCAATTTTACTTTTGTAAAGTGTGAAAGCTGTTTAGAAAGAGAAATAAACCCA
GAAATAGATATATAATGCTTAATATGTTAAAGAGATATAGGTATGATGAAATGCTTTTAC
TTTGATTCTAGAAGAGTAAAATTTTCTTCTAAGAAAAATAAACAATATTCAGACTACGAA
TACTTTATAGATAAAACACCTGTGCTATTGTTAAATGAGGAACAAATAAAAAACAATAAA
TATATCAAAAGAGTTTTTGCACATCCCCTCTGTATAAATAGCTCTTCTTGTCTCTTTATC
TACCATTTTAAATTCTTACTTATTTGGGATGAAGAGGATTATAAGAAAAAAAGTAACTAA
GGTAAGAAGTATAAATGCTCTTAGTGCAATCAAGGAAATGGCCTTCTCATTTAATGTGAA
CACCAAAACAAATAATTTCCCTCATGCAAACAGTTCTACCACCCATTATGTGCAGCAGAA
AAAAAAATGATATACTATCAATAAGGAATGAGACTTATCCATTAAAACTAATCTGTGAGA
TATTCAGATAAAGAAGAAAATATTACTTATTACTACATTATATGCAATAATCATATTGCT
CAGATCTTTTAATAAAAATAATCTTATGGCTTTTTTAATGATAAATAACAGATTTACAGC
TAATTAAAAATGAATACAGAAGAAGAACAAAAGAATTACGATGATTGGATACAGTCAAAT
TCTGATGATGAAGAATAAGAGGAAGAAAAAGATTTCTTACAAGGAAATAACAATTAAGAA
ACCGAAATAGAAACGAGAATATTAGATAAGCAAGCAAAGAGAGAAAAATTCAATAAAAAG
AATATAAATGAAAAATAAGAAATCCTCACTAAAAGAGAAAGATGTGACAAGTAATGA


>TTHERM_00071060(protein)
MLLINFENIMMSFLQNLLNQLNSQNHSNKMTRSVYKKLPSKNQKVNKNKKENVVVIQAKQ
LTSSSRINTQKKQNKTKYITKKNKKVTPRQKISKISQNQPTSQDQPSNIQNKYNFKDIQR
KMLYRKIQQNDSILKSKPYFNYFHCKDYEKDPRKCDNCFDSQITEENEMLYCEECNSFLH
KLCYSVSQDQFDLINKQETEDECNFTFVKCESCLEREINPEIDIQCLICQRDIGMMKCFY
FDSRRVKFSSKKNKQYSDYEYFIDKTPVLLLNEEQIKNNKYIKRVFAHPLCINSSSCLFI
YHFKFLLIWDEEDYKKKSNQGKKYKCSQCNQGNGLLIQCEHQNKQFPSCKQFYHPLCAAE
KKMIYYQQGMRLIHQNQSVRYSDKEENITYYYIICNNHIAQIFQQKQSYGFFNDKQQIYS
QLKMNTEEEQKNYDDWIQSNSDDEEQEEEKDFLQGNNNQETEIETRILDKQAKREKFNKK
NINEKQEILTKRERCDKQ


>TTHERM_00071060(gene)
ATGTTATTAATTAATTTTGAAAATATAATGATGTCTTTTCTTTAAAATTTATTAAATTAA
TTAAATTCATAAAATCATTCTAATAAAATGACAAGGAGTGTTTATAAAAAATTACCCTCA
AAAAATTAGAAAGTAAATAAAAATAAAAAAGAGAACGTTGTTGTTATATAAGCTAAATAA
TTAACTTCGTCTTCAAGAATTAACACTCAAAAGAAGTAAAATAAGACCAAGTACATTACT
AAGAAAAATAAAAAAGTCACACCTAGGCAGAAAATTAGCAAAATCTCTCAAAATTAGCCT
ACTAGCTAAGATTAACCGTCAAATATATAAAACAAATATAATTTTAAAGATATTTAAAGA
AAAATGCTTTACAGAAAAATATAATAAAATGATAGTATTTTAAAAAGCAAACCTTATTTT
AACTACTTCCATTGCAAAGATTATGAAAAAGATCCCAGAAAGTGTGACAACTGCTTTGAT
AGTTAAATAACAGAAGAAAATGAAATGCTTTATTGTGAAGAATGCAATTCCTTTTTACAT
AAGCTTTGTTATAGTGTGTCTTAAGACTAGTTTGATCTTATAAATAGTAAGCAATTATCA
AATAATGTGCACAAATTTTTTTCATTAATCTTTGATTAAATTATTTAGAAGAAGAAAACA
TTTTTTTGATTTTTCAATTTTTAAATTATAAATAAATCCATTTTATTTCTCCAACTACCA
AATAATTAATTCATAACCATAATTTAAATAGCTTATTAATTTATTTTTTTAATTTTAAGA
ATAAGAAACCGAAGATGAGTGCAATTTTACTTTTGTAAAGTGTGAAAGCTGTTTAGAAAG
AGAAATAAACCCAGAAATAGATATATAATGCTTAATATGTTAAAGAGATATAGGTATGAT
GAAATGCTTTTACTTTGATTCTAGAAGAGTAAAATTTTCTTCTAAGAAAAATAAACAATA
TTCAGACTACGAATACTTTATAGATAAAACACCTGTGCTATTGTTAAATGAGGAACAAAT
AAAAAACAATAAATATATCAAAAGAGTTTTTGCACATCCCCTCTGTATAAATAGCTCTTC
TTGTCTCTTTATCTACCATTTTAAATTCTTACTTATTTGGGATGAAGAGGATTATAAGAA
AAAAAGTAACTAAGGTAAGAAGTATAAATGCTCTTAGTGCAATCAAGGAAATGGCCTTCT
CATTTAAGTAATTTAATACAAATTAAAATTTTATTCAATAAAATTAACATTCTGATAGAT
AAAATTACGATGCCAGACACATACATAGTAACCTAATTTAAGAAATATTTTATAAAAATA
AAGTGTGAACACCAAAACAAATAATTTCCCTCATGCAAACAGTTCTACCACCCATTATGT
GCAGCAGAAAAAAAAATGATATACTATCAATAAGGAATGAGACTTATCCATTAAAACTAA
TCTGTGAGATATTCAGATAAAGAAGAAAATATTACTTATTACTACATTATATGCAATAAT
CATATTGCTCAGATCTTTTAATAAAAATAATCTTATGGCTTTTTTAATGATAAATAACAG
ATTTACAGCTAATTGTATATTCATTTTATATAGAAAATATGGTAAATTTATTTTATTTAT
ATAGAAAAATGAATACAGAAGAAGAACAAAAGAATTACGATGATTGGATACAGTGTAAAA
TTTAATCCTTTATTTCTATTAAATTAATAACTAAAACTAATGAATTCTGAATATATTTTA
TCTTTTCTATATAATGTAAAAATAGAAATGATAGATGAATATGGCCCTTAAAACAAAAAC
AAAGATTAAATGTCTGTCTAACTAAACTAAAATAAGGAAATAAAAGATTCATAAATTAGC
AAAGATGTTTTAAGTCATAAAATTCAAGATATTAGTGTTGGGATTTCAAATTTAGAATAG
TTTTATTATCAAAAAAATGACCCTAAAAGATAAAAAGAAAGCAAAGAACCTAGCTCAAGC
ATAGACAGCTCTTAATAGGAAGTGAGTAAAAAAAATAACAGTGTTGTATAAAACTAAAAC
CAAAATTAACCAGCATCAATTCATTTTAGTAATTGGAATTAGTCTAATTTAAAATTTGAA
AGTCAACATGAAAAAGGAAAATAAAAAAGCTAAGACCTCAAAAATGTATAGTCTGATGAG
AATAAATGTGATAAATTTTAAGCAATAGATTAAAACAATTAAGATGATGAAACAGACAAC
ATTTATAAGTTAAATATATTTGAGCAATAAAGGCTTATAGTAAAAAATGATATTGATCTC
AAATAACAATTTTAAAGCAACATAAAATAAAATTCTTTAGAAAAATAAAAATAAATTGTA
AACTACAAAGCAATAGAGTTAGAAAAAATATTTTTAGATAAATTTATGAACTAGAAAAAA
GAATTCGAGAACAAAATAACCTAAAAAAAATCTTTGAGCAATGAAAAACTGGAAAATCTT
TAACCAAAAATATTAAATTAAAAAGAACAGCAAAAACAAACTAAGTCACAAAAGAATATA
TAAAATGTACTTAAAAGAGAGCTTGGCTTAGATTTGCCTTCCCCATAGAAAAAGAAAGTG
AAAAAACTATACAAAAAAAAATTTTTAAAGCAAATTCTGATGATGAAGAATAAGAGGAAG
AAAAAGATTTCTTACAAGGAAATAACAATTAAGAAACCGAAATAGAAACGAGAATATTAG
ATAAGCAAGCAAAGAGAGAAAAATTCAATAAAAAGAATATAAATGAAAAATGTAATGAGA
GCAAATAATCAGATGAAAGTTTTCAAAATACAAGAGAAAGTAGCAGTGAAAATAGTGAAT
AAGAATAATAAAATTAGCTTAGGAGATCTAGTAGAGTGAAAAGAGCACCTGTCTCACTTG
ATAATAATATATTTACTATTTATGAACAGAAGAAATCCTCACTAAAAGAGAAAGATGTGA
CAAGTAATGAATCCAAATAATCCTCTTCTGATACTAAGCAAATAGAAGAAATAAATCTGT
TTTCTTCATCTACAAAAAAATAAAAATAAACAAAAAATAAACCAAATAGCTAGAAATAGA
ATAAATTTAAGAAATCTAAAGAAAACATTTTCTCCAACGATGAAGAAGATAAAAATATCT
ATTAAAGTAATGATGAAGACAGTGGATTAAGCGATTACTTCTATTCAAAAAGTAAACCCA
AAAAAAAAATTAAATGGGAAGATGATCAAAATTAAGTTAAGTGTGAAAAGAGTTTGAAAT
TTGATGACCTAGAAAGCTCTGCTGAAGAAGGAAACAAAAATAAAAAAAATATTTAGTAAA
AATAAAAAAAAATAAACTATAGAAACCTTGATTAACGAGAAGATGAATCATTATAAGAAG
AAAATAGTGTATATAACAATGATTCTTTTTAACTAATGCTAGATTCCTCACTAACAGAAT
AAGAGGAATTGTAAGACTTAGGATATATCATAGATAAGTTAAATTAATATGAAAATAAGG
AAAATTTAGAGTCTAAACAAGTTGAGGAAGACGAAGATATTGAAGATGATATACCAATAG
ACTTACCTGATTTAACGTCTCATTTTTTTTATGATGAAAAAGAGGAGTAAAGTTAAAGCA
AAACAATATTCTAGTTGGAATCTAATATAAATATTTTAGAATAAAAAATTTTCTTTTTAA
AGGAAGACTCTAAACTCAAAAAATACTCAATTCTAAATCATTAAAATTTTGAGATGTATT
AATAAAAGGAGTTAAAAAGATTAATGAGTAGAAAAGAGATGTTAGAATAACAAATTTAGT
AAAAGAAAAAAATAAAGATAGAAAAATATAGACAACAACTGCATTATTTTGATTAAATAT
TAGATCTGAAGTGCTTACCAAATATCAAAAGTTAAAATTTTTAAAAATGCTTAAAAAACA
ACATTGATAAGTAAGTCCCTTCTTTTAGGTTGATAAAGTATAAGCTAAGCTAAAACCAAG
ACTTCTCAAAAGAAATACCTCTTAACTTTTAAATTTGTGATCTCAATTCGAAATTTGAAA
TTATAGGATTTTCTACACTTACCAAAGTGAATATAAAGCAAAAAGAGCATGCAAATTTAA
TTCATAACTTTTTTTCCTTTCAAAAATGATTTAAAAGTGAAAATCTTTTTATATTTTTAT
ATACCATGTTAATAATAAATTAATTAATTGTAAATCAATAAATTTTACAAACTAATAATG
AGTGTTTAATAAAATTAAGTTTTAAAAAAATTTTTTTTACCAATTTAATTTTTCTAAAAT
TTTTCATTATTAATTATTAATAATAAAATAGCTTTAAATATTATTGATAAATTTTGA