Identifiers and Description

Gene Model Identifier

TTHERM_01205300

Standard Name

PYK4 (PYruvate Kinase)

Aliases

PreTt02720 | 273.m00025

Description

Pyruvate kinase, barrel domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01064 ) pyruvate kinase
  • ( PF00224 ) Pyruvate kinase, barrel domain
  • ( PF02887 ) Pyruvate kinase, alpha/beta domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01205300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20555.19.997093137033517e-262pyruvate kinase, barrel domain
-containing protein (805 aa)
OxytrichaContig21940.0.g535.002115178225629e-63Pyruvate kinase, barrel domain
DictyBaseDDB_G02832473.999543040313994e-55pyk on chromosome: 4 position
344914 to 346711
WormBaseWBGene000140015.000680012816624e-42locus:pyk-2 Pyruvate kinase
status:Confirmed UniProt:D
3YT37 protein_id:CBK19521.1
SGDYAL038W1.9993430003514377e-39CDC19 Pyruvate kinase, functio
ns as a homotetramer in glycol
ysis to convert phosphoenolpyr
uvate to pyruvate, the input f
or aerobic (TCA cycle) or anae
robic (glucose fermentation) r
espiration
Stentor CoeruleusSteCoe_22663.873997628687187e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01205300(coding)
ATGAGTAATAATAGCCCAGATAAAATATAGAACTCTTAATAAGGCGTAAACGATGACAGA
ATGGAATTTAGACATGGATAATTTGATTAAAATAACAATCATCATTCTGAGGACCAATGT
ACCTAGTAGTCTCATTATTAAGATGAAACTTCAATGAGCAATCATCAAGAAGAAAACCAA
GTTAGCCAATAAAAATATTAATAGAATTCTCCTAATCAAAAATCAGAACATTCTATGACA
CTTCCTTCTTTAGATACTCCTCTTCTTTAATTTACGAATCAGTAAGCACAAGGAAAATCT
TTACTATTTCATGAGTCAGATGATCCATTTCATTCTGAAAACCATACTCCAATTGCCATC
CATTAAAATCAACATCAAAAATCACATCACTTAATTGATAAAAAAAGGACAGTATTAAAT
TTCGTGAAATCAAGAGGAGAATTGCTGGAATATGAAAGTGAATATTATGAAAATTTGAGA
TAAAAAATTATTAGAAAGCGCAGGACAAAGATAATTGCAACTATTAATTAAAATAATTAT
AAGACATATGATTAAGTTAGAGATCTTTATTTAGCAGGTGTCAATTCATTTTTAATTAAT
ATGGCTTACTGCGAAAGATAGTTTTTAGCGCAATTATGTTAATGGAGAGATTAATTAGAA
AAAGAATATAATGTTCACATTCCACTCACTTGTGTTTTAAAAGGAAGTTTAGTTCGGATA
GGCTAACTATCATAACCTGAAACTTATTTAAGAAAGGGACAATAATTTAGAATAATTATT
AAGAAGAAGATAGTTGGTGATTCTAATATCTGTTCTGTAGACGATGATAATTTGATTAAA
AGAATAGGTGTAGGTGCTAAAATTATCATTGACTATGGTCAAGTAGGATTAACAGTTATA
AAAAAAGAAAAGAGTGATGAAACACTTAAATATTTATAAGAAAACTTTGGATATGGACAT
TAATTTACCCGCCCAATGACTGAAAAGTAAAAACGCACAGATAATTTTGTCAACACATCT
TCTGCCTCAGACGCTGACAGTTCTTCTAAGAAGAGAATGTCTGAATCACTGATAAAATAA
GTTAATTAGAAGAGTATTCCAAGGCAATCTGTTTAAGTTTTACCATATTCAACAAATATA
ATTTAAACAAATGAATATGAACAATCTGCTGATAATAGCGTAATCTCATCAAATACTACA
ACACCTTCAACTAGGAATGTATTTGCAGATTAATTAAAACAACTTAAAAAGAATACAAAC
TAAAAACTATATGATGTGATAGTTTGCACTGTTGATAGTGATTGCATGTTGAAATCTTAC
AAACCTATTTTCATTTATAAAAGTAGAGACGAAAAAGAAACATTATTTTACACTAAGTAA
AGTAAGTAGAGTAAATAATTAAATAAAAACCATTAATTTACAGATGAAAAAGATTCTAAT
GGTGAAGAATAAGATTTTGATGATGAGGAATATGATGAATTCAGTGAAAATGTCATAAGT
GCAAAAGATATCACTGATATTACAAATGCTCTTAATCATGACATTGATAGTGTATGTGTA
TCAAATGTAAGAACAGCAGAAGATATCAGAGTTGTCAAAAGGCATTGTCAGTCAAAATAG
ACAAAAATTATTGCTAAAATTTAAACTTTAGAAGGTGTATAAAATTATGATGAAATTTTA
AAGGTTTCTGATGCTGTATTGATAGCTAGAGGGTATTTAACAGTTCACATACCTGTTGAA
AAGCTTCACTTTAAATAGAAAGAACTTATTTAAAAATCAAATGAAAGCTTAAAGCCTGTT
TTAGTGTCATGTAACATATTAGATTCCATGGTTTCTTCATTGCTTCCTACTACTTGTGAA
GTAGGAGAAATATCTAATCTTGTATCAGACTATGTAGATGCTATTATTTTAAGCGGCGAA
ACAAGCTATGGAATGTATCCTATTCAAGCTGTTGAAACTCTTTCTCGTATTTGTATGGAG
ACAGAAGCAAGATAAATTTTAAAAAATTTAAATGACACGACTCGTCCAATTTAAATATAG
TGGTCAAAACAATCTGTAATAAATTCAATAGTTAAATGCACTCTTGATGCTGCCTATAAT
ATATAAGCAAATCTTATTATTGTATTTACAAGTACTGGAAGCACTGCTCTCAAAGTTTCA
AAATTAAGACCTCCATGTCCTATAATAGCTGTCACATCGAACCATAAAGTTGCAAGACAT
ATAAATTATTTATCATCAGTTACTGGTAAGGTATTCTTTACCCTTGTAGGAACTAATGTA
CTTACAGAAAAGGTGTTAGAATACGCTAAAGATTAAAAGTATGTTAAATCAGGTGATTAT
GTTATAATCACTTCTGGTGAAATAGAAAATTTATCTGGAATGACAAATAATCTAAAAATT
GTTTAAGTATAGTGA


>TTHERM_01205300(protein)
MSNNSPDKIQNSQQGVNDDRMEFRHGQFDQNNNHHSEDQCTQQSHYQDETSMSNHQEENQ
VSQQKYQQNSPNQKSEHSMTLPSLDTPLLQFTNQQAQGKSLLFHESDDPFHSENHTPIAI
HQNQHQKSHHLIDKKRTVLNFVKSRGELLEYESEYYENLRQKIIRKRRTKIIATINQNNY
KTYDQVRDLYLAGVNSFLINMAYCERQFLAQLCQWRDQLEKEYNVHIPLTCVLKGSLVRI
GQLSQPETYLRKGQQFRIIIKKKIVGDSNICSVDDDNLIKRIGVGAKIIIDYGQVGLTVI
KKEKSDETLKYLQENFGYGHQFTRPMTEKQKRTDNFVNTSSASDADSSSKKRMSESLIKQ
VNQKSIPRQSVQVLPYSTNIIQTNEYEQSADNSVISSNTTTPSTRNVFADQLKQLKKNTN
QKLYDVIVCTVDSDCMLKSYKPIFIYKSRDEKETLFYTKQSKQSKQLNKNHQFTDEKDSN
GEEQDFDDEEYDEFSENVISAKDITDITNALNHDIDSVCVSNVRTAEDIRVVKRHCQSKQ
TKIIAKIQTLEGVQNYDEILKVSDAVLIARGYLTVHIPVEKLHFKQKELIQKSNESLKPV
LVSCNILDSMVSSLLPTTCEVGEISNLVSDYVDAIILSGETSYGMYPIQAVETLSRICME
TEARQILKNLNDTTRPIQIQWSKQSVINSIVKCTLDAAYNIQANLIIVFTSTGSTALKVS
KLRPPCPIIAVTSNHKVARHINYLSSVTGKVFFTLVGTNVLTEKVLEYAKDQKYVKSGDY
VIITSGEIENLSGMTNNLKIVQVQ


>TTHERM_01205300(gene)
ATGAGTAATAATAGCCCAGATAAAATATAGAACTCTTAATAAGGCGTAAACGATGACAGA
ATGGAATTTAGACATGGATAATTTGATTAAAATAACAATCATCATTCTGAGGACCAATGT
ACCTAGTAGTCTCATTATTAAGATGAAACTTCAATGAGCAATCATCAAGAAGAAAACCAA
GTTAGCCAATAAAAATATTAATAGAATTCTCCTAATCAAAAATCAGAACATTCTATGACA
CTTCCTTCTTTAGATACTCCTCTTCTTTAATTTACGAATCAGTAAGCACAAGGAAAATCT
TTACTATTTCATGAGTCAGATGATCCATTTCATTCTGAAAACCATACTCCAATTGCCATC
CATTAAAATCAACATCAAAAATCACATCACTTAATTGATAAAAAAAGGACAGTATTAAAT
TTCGTGAAATCAAGAGGAGAATTGCTGGAATATGAAAGTGAATATTATGAAAATTTGAGA
TAAAAAATTATTAGAAAGCGCAGGACAAAGATAATTGCAACTATTAATTAAAATAATTAT
AAGACATATGATTAAGTTAGAGATCTTTATTTAGCAGGTGTCAATTCATTTTTAATTAAT
ATGGCTTACTGCGAAAGATAGTTTTTAGCGCAATTATGTTAATGGAGAGATTAATTAGAA
AAAGAATATAATGTTCACATTCCACTCACTTGTGTTTTAAAAGGAAGTTTAGTTCGGATA
GGCTAACTATCATAACCTGAAACTTATTTAAGAAAGGTAAAAATACTTACAAAATTAATA
ATATTAAAAAAGACATTATTAAGCTATAATTAAAATACAAAAAATAGTTTATTTTAAAAA
GCAAGCGTTTTAACCTTAAAAATAAATTTAAATAATAGCTAATAATGAAGTGAGTTCATC
CATGAATAGCTTTATTAACTATTCATTTTTAAAATATTAGGGACAATAATTTAGAATAAT
TATTAAGAAGAAGATAGTTGGTGATTCTAATATCTGTTCTGTAGACGATGATAATTTGAT
TAAAAGAATAGGTGTAGGTGCTAAAATTATCATTGACTATGGTCAAGTAGGATTAACAGT
TATAAAAAAAGAAAAGAGTGATGAAACACTTAAATATTTATAAGAAAACTTTGGATATGG
ACATTAATTTACCCGCCCAATGACTGAAAAGTAAAAACGCACAGATAATTTTGTCAACAC
ATCTTCTGCCTCAGACGCTGACAGTTCTTCTAAGAAGAGAATGTCTGAATCACTGATAAA
ATAAGTTAATTAGAAGAGTATTCCAAGGCAATCTGTTTAAGTTTTACCATATTCAACAAA
TATAATTTAAACAAATGAATATGAACAATCTGCTGATAATAGCGTAATCTCATCAAATAC
TACAACACCTTCAACTAGGAATGTATTTGCAGATTAATTAAAACAACTTAAAAAGAATAC
AAACTAAAAACTATATGATGTGATAGTTTGCACTGTTGATAGTGATTGCATGTTGAAATC
TTACAAACCTATTTTCATTTATAAAAGTAGAGACGAAAAAGAAACATTATTTTACACTAA
GTAAAGTAAGTAGAGTAAATAATTAAATAAAAACCATTAATTTACAGATGAAAAAGATTC
TAATGGTGAAGAATAAGATTTTGATGATGAGGAATATGATGAATTCAGTGAAAATGTCAT
AAGTGCAAAAGATATCACTGATATTACAAATGCTCTTAATCATGACATTGATAGTGTATG
TGTATCAAATGTAAGAACAGCAGAAGATATCAGAGTTGTCAAAAGGCATTGTCAGTCAAA
ATAGACAAAAATTATTGCTAAAATTTAAACTTTAGAAGGTAACTAACTAACTAACCAAAT
AGCTTTTTAAATTTTATATATATAATTTTAATTAAAATTAGGTGTATAAAATTATGATGA
AATTTTAAAGGTTTCTGATGCTGTATTGATAGCTAGAGGGTATTTAACAGTTCACATACC
TGTTGAAAAGCTTCACTTTAAATAGAAAGAACTTATTTAAAAATCAAATGAAAGCTTAAA
GCCTGTTTTAGTGTCATGTAACATATTAGATTCCATGGTTTCTTCATTGCTTCCTACTAC
TTGTGAAGTAGGAGAAATATCTAATCTTGTATCAGACTATGTAGATGCTATTATTTTAAG
CGGCGAAACAAGCTATGGAATGTATCCTATTCAAGCTGTTGAAACTCTTTCTCGTATTTG
TATGGAGACAGAAGCAAGATAAATTTTAAAAAATTTAAATGACACGACTCGTCCAATTTA
AATATAGTGGTCAAAACAATCTGTAATAAATTCAATAGTTAAATGCACTCTTGATGCTGC
CTATAATATATAAGCAAATCTTATTATTGTATTTACAAGTACTGGAAGCACTGCTCTCAA
AGTTTCAAAATTAAGACCTCCATGTCCTATAATAGCTGTCACATCGAACCATAAAGTTGC
AAGACATATAAATTATTTATCATCAGTTACTGGTAAGGTATTCTTTACCCTTGTAGGAAC
TAATGTACTTACAGAAAAGGTGTTAGAATACGCTAAAGATTAAAAGTATGTTAAATCAGG
TGATTATGTTATAATCACTTCTGGTGAAATAGAAAATTTATCTGGAATGACAAATAATCT
AAAAATTGTTTAAGTATAGTGA