Identifiers and Description

Gene Model Identifier

TTHERM_01016110

Standard Name

PYK3 (PYruvate Kinase)

Aliases

PreTt02645 | 198.m00065 | 3746.m00329

Description

Pyruvate kinase, barrel domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01016110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20170.19.997093137033517e-262pyruvate kinase, barrel domain
-containing protein (759 aa)
OxytrichaContig21940.0.g538.001993295941272e-61Pyruvate kinase, barrel domain
DictyBaseDDB_G02832474.999083770298882e-50pyk on chromosome: 4 position
344914 to 346711
WormBaseWBGene000140019.999888128184441e-42locus:pyk-2 Pyruvate kinase
status:Confirmed UniProt:D
3YT37 protein_id:CBK19521.1
SGDYAL038W2.00017271388466e-38CDC19 Pyruvate kinase, functio
ns as a homotetramer in glycol
ysis to convert phosphoenolpyr
uvate to pyruvate, the input f
or aerobic (TCA cycle) or anae
robic (glucose fermentation) r
espiration
Stentor CoeruleusSteCoe_22661.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01016110(coding)
ATGAGCGAAGAATTTAAGATTGTTGGAGGTGAAGACAACAATGAAGAAATAAGCAATCAT
TTAAAAGTTTCACCTAAAAAAGTATCTAACAAGGTTATAAGGAAGCCATCCATGCACTAT
GTAAGATCTAGAGATGAGCTACTTGAAGAAGAAAATTAACATTTTGAAAGTTTAAGGAAA
AAGTATGTGAAAACTCGCAGAACTAAGATCGTAGGTACAATATCAAGTTTTTATAGTTCA
TACGAAAATTTAAAATCAATGGTAGAAGCTGGATTAAACTCGTTTATGGTTAATATGGCT
TATTGTACACCAGACTTGCTGGTTACTTTAAGGAAGCACAGAGATGCTCTTGAAAAAGAA
TTTGATATATAATTACCAATTACTTGTGTTCTTAAAGGAACCTTAGTAAGAATAGGTACA
TTGATGTAGCCTGAAATATTCTTAAGAAAGGGCTAGGAGTATAGGATAGTCTTAAATCAT
AAGGTTTTAGGTAATAGCCTTTATTGTGCAGTCGATGATAAGGAGATTATAAGAAGAGTA
AAAGTAGGTAATTAAATTCTAATAGATTATGGCTAAATTTCTATGACGATTAAAAGAATT
GAAAAATCCGATTAAAGTTTAAAGCTGCTTCGAGAGTAAAATGGCTATTAGCATGAAGAT
TTCCTAGAAACCTTCACTGAAAAGAAAAAAAGGTTTTATCCAAACCTGTATTTTGGAAGA
GAGAGCTCGAGTGATCAAGAAAATCCAAATAATGGTAGCATTTTCTCTGAAGATGATATA
CGTGCTTTTAACAGCTAAGATAATATAGATGATTCATTCAGCAGCTCTTAGATATCATAA
ACAAGTTAAAACAAAACAAATTTTAAGAACCTTTGCCATTCAACTTAGCATTTAGACTGT
TAAGGTAATAACAATAAATAGGGTTAGTTCATCAGTTTAGGTAGTAGAAAGAATATATAA
ATAACTGAAAATCAAATTATATCTGAAAGGTTTATGTAAAACGCGAATTCACCTAGCAAA
GATACTCCAAAATATTTAAATTCTATTTAGCAAAATCAAAATAATGGAAATAGCAATTAA
TTTTAGAATAAATTTGCTGAACAACTAAGATAAAAAAAGCAAGGTAAAAAGAAAATTTAT
GATGTTATAGTTTGTGAAGTAGATAGCGATTGCCTTATCAAATCTTACAAGCCAATTTTT
ATATATGAGAAGGATTATAATTAAAAGAAAGACTAACTCCGTAAGTATAGACATAAGAAC
TTAAATAATGATATGGGTTTAATAGATTCTATTGGCGAATAGCTTTCAGAAGACGACGAA
CGTGCTGAAGACTATGAAGGTGAAGAATGCATAACACCAAAAGATATTACTGACATAAAT
CACTGCATAAATAATGATATTGATTGTATTTGCGTTTCAAATGTCCGCTCAGCAAGAGAT
ATTAAGGCTGTAAGAAATTTAATTGGAGAGGATAGAGGAGTCAGGATTATGGCTAAAATT
CAAACACCTGAATCTGTAGAAAACTTTGAAGAGATTGTAAAAGCTTCAGACGGTGTGTAG
ATTGCTAGAGGATATTTAACTGTTCATATGCCTGTGGAAAAATTATTTGCAAAGTAGAAA
GAAATGATTCATAAATGTCATGAGCATTTGAAGCCTGTCCTTGTATCATGTAATATTTTA
GATTCTATGGTTTCTTCGCTTCTTCCTACTATGTGTGAAGTTGGTGAAATATCTAATTTA
GTTAATGATTATGTAGACAATATTGTCTTATCTTCTGAAACTTCTTGTGGAAATCACCCA
GTTCAAGCAATTAAAACTTTAAGTCGTATATGTGTTGAAGCTGAAGCTTTGCGTATTATG
AAAAGACTATAAAATCCTTCTCATTCTGATATAGTTTCTATTAAATCTCAATCTAATGCA
ATTCCATGTTGTATAATAAATTGCAGTTTAGAAGCTGCTTATTAAGTTCATGCCTCAGTC
ATTATGGTTTTTACTACCAGAGGATATACTGCATTGAAGCTCTCTAAACTAAGACCTCCT
TGTCCTATTATTGCTGTTACGTGCCATAAAAAAGTGGCAAGAAATCTCTCATCTGTATCT
GCTGTCAATAGTATATTATTTGGAAGCTTAATAGGTACTGAAGTTTTAATCAAAAGAGTA
ATAGATAAATTAAAATTAACTGGATTACTTAAAGTTGGAGACTTCGTTGTGATTACTAGT
GGTGATATAGAGAATTTAGCAAATTAAACAAACAATTTAAGAATATACACGGTCTAGTGA


>TTHERM_01016110(protein)
MSEEFKIVGGEDNNEEISNHLKVSPKKVSNKVIRKPSMHYVRSRDELLEEENQHFESLRK
KYVKTRRTKIVGTISSFYSSYENLKSMVEAGLNSFMVNMAYCTPDLLVTLRKHRDALEKE
FDIQLPITCVLKGTLVRIGTLMQPEIFLRKGQEYRIVLNHKVLGNSLYCAVDDKEIIRRV
KVGNQILIDYGQISMTIKRIEKSDQSLKLLREQNGYQHEDFLETFTEKKKRFYPNLYFGR
ESSSDQENPNNGSIFSEDDIRAFNSQDNIDDSFSSSQISQTSQNKTNFKNLCHSTQHLDC
QGNNNKQGQFISLGSRKNIQITENQIISERFMQNANSPSKDTPKYLNSIQQNQNNGNSNQ
FQNKFAEQLRQKKQGKKKIYDVIVCEVDSDCLIKSYKPIFIYEKDYNQKKDQLRKYRHKN
LNNDMGLIDSIGEQLSEDDERAEDYEGEECITPKDITDINHCINNDIDCICVSNVRSARD
IKAVRNLIGEDRGVRIMAKIQTPESVENFEEIVKASDGVQIARGYLTVHMPVEKLFAKQK
EMIHKCHEHLKPVLVSCNILDSMVSSLLPTMCEVGEISNLVNDYVDNIVLSSETSCGNHP
VQAIKTLSRICVEAEALRIMKRLQNPSHSDIVSIKSQSNAIPCCIINCSLEAAYQVHASV
IMVFTTRGYTALKLSKLRPPCPIIAVTCHKKVARNLSSVSAVNSILFGSLIGTEVLIKRV
IDKLKLTGLLKVGDFVVITSGDIENLANQTNNLRIYTVQ


>TTHERM_01016110(gene)
ATGAGCGAAGAATTTAAGATTGTTGGAGGTGAAGACAACAATGAAGAAATAAGCAATCAT
TTAAAAGTTTCACCTAAAAAAGTATCTAACAAGGTTATAAGGAAGCCATCCATGCACTAT
GTAAGATCTAGAGATGAGCTACTTGAAGAAGAAAATTAACATTTTGAAAGTTTAAGGAAA
AAGTATGTGAAAACTCGCAGAACTAAGATCGTAGGTACAATATCAAGTTTTTATAGTTCA
TACGAAAATTTAAAATCAATGGTAGAAGCTGGATTAAACTCGTTTATGGTTAATATGGCT
TATTGTACACCAGACTTGCTGGTTACTTTAAGGAAGCACAGAGATGCTCTTGAAAAAGAA
TTTGATATATAATTACCAATTACTTGTGTTCTTAAAGGAACCTTAGTAAGAATAGGTACA
TTGATGTAGCCTGAAATATTCTTAAGAAAGGGCTAGGAGTATAGGATAGTCTTAAATCAT
AAGGTTTTAGGTAATAGCCTTTATTGTGCAGTCGATGATAAGGAGATTATAAGAAGAGTA
AAAGTAGGTAATTAAATTCTAATAGATTATGGCTAAATTTCTATGACGATTAAAAGAATT
GAAAAATCCGATTAAAGTTTAAAGCTGCTTCGAGAGTAAAATGGCTATTAGCATGAAGAT
TTCCTAGAAACCTTCACTGAAAAGAAAAAAAGGTTTTATCCAAACCTGTATTTTGGAAGA
GAGAGCTCGAGTGATCAAGAAAATCCAAATAATGGTAGCATTTTCTCTGAAGATGATATA
CGTGCTTTTAACAGCTAAGATAATATAGATGATTCATTCAGCAGCTCTTAGATATCATAA
ACAAGTTAAAACAAAACAAATTTTAAGAACCTTTGCCATTCAACTTAGCATTTAGACTGT
TAAGGTAATAACAATAAATAGGGTTAGTTCATCAGTTTAGGTAGTAGAAAGAATATATAA
ATAACTGAAAATCAAATTATATCTGAAAGGTTTATGTAAAACGCGAATTCACCTAGCAAA
GATACTCCAAAATATTTAAATTCTATTTAGCAAAATCAAAATAATGGAAATAGCAATTAA
TTTTAGAATAAATTTGCTGAACAACTAAGATAAAAAAAGCAAGGTAAAAAGAAAATTTAT
GATGTTATAGTTTGTGAAGTAGATAGCGATTGCCTTATCAAATCTTACAAGCCAATTTTT
ATATATGAGAAGGATTATAATTAAAAGAAAGACTAACTCCGTAAGTATAGACATAAGAAC
TTAAATAATGATATGGGTTTAATAGATTCTATTGGCGAATAGCTTTCAGAAGACGACGAA
CGTGCTGAAGACTATGAAGGTGAAGGTAAATAAATAAACAAACAAAAAAGCAAATACTTT
TCATTAAAAATTTAAAAAGTTTTTTTTGGAAAATAAACAATTTGTTATTAAATTTAAATA
TTTTGAATTTGTTTTTCACCAAAATCTACAAAATAAATTTATCTAAAACTCAATAAAATA
ATAAAAATTAATTATTTTAATTTATAGAATGCATAACACCAAAAGATATTACTGACATAA
ATCACTGCATAAATAATGATATTGATTGTATTTGCGTTTCAAATGTCCGCTCAGCAAGAG
ATATTAAGGCTGTAAGAAATTTAATTGGAGAGGATAGAGGAGTCAGGATTATGGCTAAAA
TTCAAACACCTGAATGTAAAAATAATATTTTCTTCTACTTTAATTATTTATGTATTAATA
AGCAACTTAAACACAATAAATTATTACTCAAATGAAATTTTAATCTCTAAATTTTTATTT
AATATTTATGACGAACTTAAATTAAATCATAAATTTAATTAAGAAATAAATATCACTTTC
TTAAGTCATGCAAATTTCAAAAACTATTTAAAAAAAAATATAATCATATTATAAATAATC
TATAATTTTAACTCTAAAATATTTTTATTTTAATTAATTATTTATTTTATAATTTGCTTT
TTATAAAATTTAGCTGTAGAAAACTTTGAAGAGATTGTAAAAGCTTCAGACGGTGTGTAG
ATTGCTAGAGGATATTTAACTGTTCATATGCCTGTGGAAAAATTATTTGCAAAGTAGAAA
GAAATGATTCATAAATGTCATGAGCATTTGAAGCCTGTCCTTGTATCATGTAATATTTTA
GATTCTATGGTTTCTTCGCTTCTTCCTACTATGTGTGAAGTTGGTGAAATATCTAATTTA
GTTAATGATTATGTAGACAATATTGTCTTATCTTCTGAAACTTCTTGTGGAAATCACCCA
GTTCAAGCAATTAAAACTTTAAGTCGTATATGTGTTGAAGCTGAAGCTTTGCGTATTATG
AAAAGACTATAAAATCCTTCTCATTCTGATATAGTTTCTATTAAATCTCAATCTAATGCA
ATTCCATGTTGTATAATAAATTGCAGTTTAGAAGCTGCTTATTAAGTTCATGCCTCAGTC
ATTATGGTTTTTACTACCAGAGGATATACTGCATTGAAGCTCTCTAAACTAAGACCTCCT
TGTCCTATTATTGCTGTTACGTGCCATAAAAAAGTGGCAAGAAATCTCTCATCTGTATCT
GCTGTCAATAGTATATTATTTGGAAGCTTAATAGGTACTGAAGTTTTAATCAAAAGAGTA
ATAGATAAATTAAAATTAACTGGATTACTTAAAGTTGGAGACTTCGTTGTGATTACTAGT
GGTGATATAGAGAATTTAGCAAATTAAACAAACAATTTAAGAATATACACGGTCTAGTGA