Identifiers and Description

Gene Model Identifier

TTHERM_01016110

Standard Name

PYK3 (PYruvate Kinase)

Aliases

PreTt02645 | 198.m00065 | 3746.m00329

Description

PYK3 pyruvate kinase complex alpha subunit; Pyruvate kinase- barrel domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01016110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20170.19.997093137033517e-262pyruvate kinase, barrel domain
-containing protein (759 aa)
OxytrichaContig21940.0.g538.001993295941272e-61Pyruvate kinase, barrel domain
DictyBaseDDB_G02832474.999083770298882e-50pyk on chromosome: 4 position
344914 to 346711
WormBaseWBGene000140019.999888128184441e-42locus:pyk-2 Pyruvate kinase
status:Confirmed UniProt:D
3YT37 protein_id:CBK19521.1
SGDYAL038W2.00017271388466e-38CDC19 Pyruvate kinase, functio
ns as a homotetramer in glycol
ysis to convert phosphoenolpyr
uvate to pyruvate, the input f
or aerobic (TCA cycle) or anae
robic (glucose fermentation) r
espiration
Stentor CoeruleusSteCoe_22661.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01016110(coding)
ATGAGCGAAGAATTTAAGATTGTTGGAGGTGAAGACAACAATGAAGAAATAAGCAATCAT
TTAAAAGTTTCACCTAAAAAAGTATCTAACAAGGTTATAAGGAAGCCATCCATGCACTAT
GTAAGATCTAGAGATGAGCTACTTGAAGAAGAAAATTAACATTTTGAAAGTTTAAGGAAA
AAGTATGTGAAAACTCGCAGAACTAAGATCGTAGGTACAATATCAAGTTTTTATAGTTCA
TACGAAAATTTAAAATCAATGGTAGAAGCTGGATTAAACTCGTTTATGGTTAATATGGCT
TATTGTACACCAGACTTGCTGGTTACTTTAAGGAAGCACAGAGATGCTCTTGAAAAAGAA
TTTGATATATAATTACCAATTACTTGTGTTCTTAAAGGAACCTTAGTAAGAATAGGTACA
TTGATGTAGCCTGAAATATTCTTAAGAAAGGGCTAGGAGTATAGGATAGTCTTAAATCAT
AAGGTTTTAGGTAATAGCCTTTATTGTGCAGTCGATGATAAGGAGATTATAAGAAGAGTA
AAAGTAGGTAATTAAATTCTAATAGATTATGGCTAAATTTCTATGACGATTAAAAGAATT
GAAAAATCCGATTAAAGTTTAAAGCTGCTTCGAGAGTAAAATGGCTATTAGCATGAAGAT
TTCCTAGAAACCTTCACTGAAAAGAAAAAAAGGTTTTATCCAAACCTGTATTTTGGAAGA
GAGAGCTCGAGTGATCAAGAAAATCCAAATAATGGTAGCATTTTCTCTGAAGATGATATA
CGTGCTTTTAACAGCTAAGATAATATAGATGATTCATTCAGCAGCTCTTAGATATCATAA
ACAAGTTAAAACAAAACAAATTTTAAGAACCTTTGCCATTCAACTTAGCATTTAGACTGT
TAAGGTAATAACAATAAATAGGGTTAGTTCATCAGTTTAGGTAGTAGAAAGAATATATAA
ATAACTGAAAATCAAATTATATCTGAAAGGTTTATGTAAAACGCGAATTCACCTAGCAAA
GATACTCCAAAATATTTAAATTCTATTTAGCAAAATCAAAATAATGGAAATAGCAATTAA
TTTTAGAATAAATTTGCTGAACAACTAAGATAAAAAAAGCAAGGTAAAAAGAAAATTTAT
GATGTTATAGTTTGTGAAGTAGATAGCGATTGCCTTATCAAATCTTACAAGCCAATTTTT
ATATATGAGAAGGATTATAATTAAAAGAAAGACTAACTCCGTAAGTATAGACATAAGAAC
TTAAATAATGATATGGGTTTAATAGATTCTATTGGCGAATAGCTTTCAGAAGACGACGAA
CGTGCTGAAGACTATGAAGGTGAAGAATGCATAACACCAAAAGATATTACTGACATAAAT
CACTGCATAAATAATGATATTGATTGTATTTGCGTTTCAAATGTCCGCTCAGCAAGAGAT
ATTAAGGCTGTAAGAAATTTAATTGGAGAGGATAGAGGAGTCAGGATTATGGCTAAAATT
CAAACACCTGAATCTGTAGAAAACTTTGAAGAGATTGTAAAAGCTTCAGACGGTGTGTAG
ATTGCTAGAGGATATTTAACTGTTCATATGCCTGTGGAAAAATTATTTGCAAAGTAGAAA
GAAATGATTCATAAATGTCATGAGCATTTGAAGCCTGTCCTTGTATCATGTAATATTTTA
GATTCTATGGTTTCTTCGCTTCTTCCTACTATGTGTGAAGTTGGTGAAATATCTAATTTA
GTTAATGATTATGTAGACAATATTGTCTTATCTTCTGAAACTTCTTGTGGAAATCACCCA
GTTCAAGCAATTAAAACTTTAAGTCGTATATGTGTTGAAGCTGAAGCTTTGCGTATTATG
AAAAGACTATAAAATCCTTCTCATTCTGATATAGTTTCTATTAAATCTCAATCTAATGCA
ATTCCATGTTGTATAATAAATTGCAGTTTAGAAGCTGCTTATTAAGTTCATGCCTCAGTC
ATTATGGTTTTTACTACCAGAGGATATACTGCATTGAAGCTCTCTAAACTAAGACCTCCT
TGTCCTATTATTGCTGTTACGTGCCATAAAAAAGTGGCAAGAAATCTCTCATCTGTATCT
GCTGTCAATAGTATATTATTTGGAAGCTTAATAGGTACTGAAGTTTTAATCAAAAGAGTA
ATAGATAAATTAAAATTAACTGGATTACTTAAAGTTGGAGACTTCGTTGTGATTACTAGT
GGTGATATAGAGAATTTAGCAAATTAAACAAACAATTTAAGAATATACACGGTCTAGTGA


>TTHERM_01016110(protein)
MSEEFKIVGGEDNNEEISNHLKVSPKKVSNKVIRKPSMHYVRSRDELLEEENQHFESLRK
KYVKTRRTKIVGTISSFYSSYENLKSMVEAGLNSFMVNMAYCTPDLLVTLRKHRDALEKE
FDIQLPITCVLKGTLVRIGTLMQPEIFLRKGQEYRIVLNHKVLGNSLYCAVDDKEIIRRV
KVGNQILIDYGQISMTIKRIEKSDQSLKLLREQNGYQHEDFLETFTEKKKRFYPNLYFGR
ESSSDQENPNNGSIFSEDDIRAFNSQDNIDDSFSSSQISQTSQNKTNFKNLCHSTQHLDC
QGNNNKQGQFISLGSRKNIQITENQIISERFMQNANSPSKDTPKYLNSIQQNQNNGNSNQ
FQNKFAEQLRQKKQGKKKIYDVIVCEVDSDCLIKSYKPIFIYEKDYNQKKDQLRKYRHKN
LNNDMGLIDSIGEQLSEDDERAEDYEGEECITPKDITDINHCINNDIDCICVSNVRSARD
IKAVRNLIGEDRGVRIMAKIQTPESVENFEEIVKASDGVQIARGYLTVHMPVEKLFAKQK
EMIHKCHEHLKPVLVSCNILDSMVSSLLPTMCEVGEISNLVNDYVDNIVLSSETSCGNHP
VQAIKTLSRICVEAEALRIMKRLQNPSHSDIVSIKSQSNAIPCCIINCSLEAAYQVHASV
IMVFTTRGYTALKLSKLRPPCPIIAVTCHKKVARNLSSVSAVNSILFGSLIGTEVLIKRV
IDKLKLTGLLKVGDFVVITSGDIENLANQTNNLRIYTVQ


>TTHERM_01016110(gene)
ATGAGCGAAGAATTTAAGATTGTTGGAGGTGAAGACAACAATGAAGAAATAAGCAATCAT
TTAAAAGTTTCACCTAAAAAAGTATCTAACAAGGTTATAAGGAAGCCATCCATGCACTAT
GTAAGATCTAGAGATGAGCTACTTGAAGAAGAAAATTAACATTTTGAAAGTTTAAGGAAA
AAGTATGTGAAAACTCGCAGAACTAAGATCGTAGGTACAATATCAAGTTTTTATAGTTCA
TACGAAAATTTAAAATCAATGGTAGAAGCTGGATTAAACTCGTTTATGGTTAATATGGCT
TATTGTACACCAGACTTGCTGGTTACTTTAAGGAAGCACAGAGATGCTCTTGAAAAAGAA
TTTGATATATAATTACCAATTACTTGTGTTCTTAAAGGAACCTTAGTAAGAATAGGTACA
TTGATGTAGCCTGAAATATTCTTAAGAAAGGGCTAGGAGTATAGGATAGTCTTAAATCAT
AAGGTTTTAGGTAATAGCCTTTATTGTGCAGTCGATGATAAGGAGATTATAAGAAGAGTA
AAAGTAGGTAATTAAATTCTAATAGATTATGGCTAAATTTCTATGACGATTAAAAGAATT
GAAAAATCCGATTAAAGTTTAAAGCTGCTTCGAGAGTAAAATGGCTATTAGCATGAAGAT
TTCCTAGAAACCTTCACTGAAAAGAAAAAAAGGTTTTATCCAAACCTGTATTTTGGAAGA
GAGAGCTCGAGTGATCAAGAAAATCCAAATAATGGTAGCATTTTCTCTGAAGATGATATA
CGTGCTTTTAACAGCTAAGATAATATAGATGATTCATTCAGCAGCTCTTAGATATCATAA
ACAAGTTAAAACAAAACAAATTTTAAGAACCTTTGCCATTCAACTTAGCATTTAGACTGT
TAAGGTAATAACAATAAATAGGGTTAGTTCATCAGTTTAGGTAGTAGAAAGAATATATAA
ATAACTGAAAATCAAATTATATCTGAAAGGTTTATGTAAAACGCGAATTCACCTAGCAAA
GATACTCCAAAATATTTAAATTCTATTTAGCAAAATCAAAATAATGGAAATAGCAATTAA
TTTTAGAATAAATTTGCTGAACAACTAAGATAAAAAAAGCAAGGTAAAAAGAAAATTTAT
GATGTTATAGTTTGTGAAGTAGATAGCGATTGCCTTATCAAATCTTACAAGCCAATTTTT
ATATATGAGAAGGATTATAATTAAAAGAAAGACTAACTCCGTAAGTATAGACATAAGAAC
TTAAATAATGATATGGGTTTAATAGATTCTATTGGCGAATAGCTTTCAGAAGACGACGAA
CGTGCTGAAGACTATGAAGGTGAAGGTAAATAAATAAACAAACAAAAAAGCAAATACTTT
TCATTAAAAATTTAAAAAGTTTTTTTTGGAAAATAAACAATTTGTTATTAAATTTAAATA
TTTTGAATTTGTTTTTCACCAAAATCTACAAAATAAATTTATCTAAAACTCAATAAAATA
ATAAAAATTAATTATTTTAATTTATAGAATGCATAACACCAAAAGATATTACTGACATAA
ATCACTGCATAAATAATGATATTGATTGTATTTGCGTTTCAAATGTCCGCTCAGCAAGAG
ATATTAAGGCTGTAAGAAATTTAATTGGAGAGGATAGAGGAGTCAGGATTATGGCTAAAA
TTCAAACACCTGAATGTAAAAATAATATTTTCTTCTACTTTAATTATTTATGTATTAATA
AGCAACTTAAACACAATAAATTATTACTCAAATGAAATTTTAATCTCTAAATTTTTATTT
AATATTTATGACGAACTTAAATTAAATCATAAATTTAATTAAGAAATAAATATCACTTTC
TTAAGTCATGCAAATTTCAAAAACTATTTAAAAAAAAATATAATCATATTATAAATAATC
TATAATTTTAACTCTAAAATATTTTTATTTTAATTAATTATTTATTTTATAATTTGCTTT
TTATAAAATTTAGCTGTAGAAAACTTTGAAGAGATTGTAAAAGCTTCAGACGGTGTGTAG
ATTGCTAGAGGATATTTAACTGTTCATATGCCTGTGGAAAAATTATTTGCAAAGTAGAAA
GAAATGATTCATAAATGTCATGAGCATTTGAAGCCTGTCCTTGTATCATGTAATATTTTA
GATTCTATGGTTTCTTCGCTTCTTCCTACTATGTGTGAAGTTGGTGAAATATCTAATTTA
GTTAATGATTATGTAGACAATATTGTCTTATCTTCTGAAACTTCTTGTGGAAATCACCCA
GTTCAAGCAATTAAAACTTTAAGTCGTATATGTGTTGAAGCTGAAGCTTTGCGTATTATG
AAAAGACTATAAAATCCTTCTCATTCTGATATAGTTTCTATTAAATCTCAATCTAATGCA
ATTCCATGTTGTATAATAAATTGCAGTTTAGAAGCTGCTTATTAAGTTCATGCCTCAGTC
ATTATGGTTTTTACTACCAGAGGATATACTGCATTGAAGCTCTCTAAACTAAGACCTCCT
TGTCCTATTATTGCTGTTACGTGCCATAAAAAAGTGGCAAGAAATCTCTCATCTGTATCT
GCTGTCAATAGTATATTATTTGGAAGCTTAATAGGTACTGAAGTTTTAATCAAAAGAGTA
ATAGATAAATTAAAATTAACTGGATTACTTAAAGTTGGAGACTTCGTTGTGATTACTAGT
GGTGATATAGAGAATTTAGCAAATTAAACAAACAATTTAAGAATATACACGGTCTAGTGA