Identifiers and Description

Gene Model Identifier

TTHERM_00145990

Standard Name

PYK2 (PYruvate Kinase)

Aliases

PreTt26806 | 11.m00503 | 3702.m00225

Description

pyruvate kinase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00166 ) chaperonin GroS
  • ( TIGR01064 ) pyruvate kinase
  • ( TIGR01634 ) phage tail protein I
  • ( PF00224 ) Pyruvate kinase, barrel domain
  • ( PF02887 ) Pyruvate kinase, alpha/beta domain
  • ( PF03328 ) HpcH/HpaI aldolase/citrate lyase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00145990

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04674.19.997093137033517e-262pyruvate kinase (497 aa)
OxytrichaContig18083.0.g1141.9994249217050915e-157Pyruvate kinase, barrel domain
DictyBaseDDB_G02832476.999872280442742e-128pyk on chromosome: 4 position
344914 to 346711
WormBaseWBGene000140011.000434858898539e-105locus:pyk-2 Pyruvate kinase
status:Confirmed UniProt:D
3YT36 protein_id:CBK19520.1
SGDYAL038W4.999027844641202e-91CDC19 Pyruvate kinase, functio
ns as a homotetramer in glycol
ysis to convert phosphoenolpyr
uvate to pyruvate, the input f
or aerobic (TCA cycle) or anae
robic (glucose fermentation) r
espiration
Stentor CoeruleusSteCoe_66115.301718666092324e-65

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00145990(coding)
ATGTCATAAATCCTAAGATACCAAGGCAAATTGATCTAATATAGGAAGATTTAATTTACT
ATTAAAAATTTGTAATACTTATATTAAAGTGAATGTTTAAAGATTACTATATCATAAAAT
ATTAATTAAGTAAATCTATATTACGTATACAGTGAATTATCTAAACAGATATAAACGCAA
AACTAAATATATATTTCAAAATAATTAAAAGTTATAGCAAATCATAACACTATTTTTAAG
ATAGCTAAGGCAGACCAAAGAATGAACACATTTGGATAAAATTTCAATTTAAATAAGGTT
TTAAAGGAAACTGATTACTCAAAAAGAAAAACCAAAATAGTTTGTACATTAGGCCCTTAA
AGCTCTAGTGTAGAAATGATATGCAAGCTTCTTGATTCAGGAATGAATGTTGCAAGAATT
ACTTATTGTCATGGATTAAAGCAATTTTATGAAACAGTAATTAGCAATTTGAAATAAGCA
TTCAAACTCAGAAAAAGCATTCAATGTTCTATTATGTTAGATACAAGGGGTCCAGATATT
AGAACTTCTTTACTAAAGGATAAAAAACCTATTGAAATAAAGAAAGGATAAAAATTAAAA
ATAATGGATGAGCAGCCAGAATATGAAGGAGATGAGTAAGGGATAGGTTGTTCTATAGCT
CTTTCAAAATTAGTTTAAGTTGGATAACATGTGTTATTATCAGATAATACAATATATTCT
CATGTTGTTGAAGTAAATGAGTCTGATATTGTTGTCTAGTTTGAAAATGAGGGAATTTTA
AACGAAGTAAAAAATGTAAGACTTCCAGGTGTTAAAATAGATTTGCCAACAATAAGTGAA
GAAGATGAAGATTTTATCATTTCATAAGGATTAGAAAAAGGTGTAGATTTTATAGCTGTA
TCTTTCGTACGTAGTGGGGAAGATATTGAATATGTAAGAGATCTTTTATCTCCTAGAGGG
GAGCATATTAAAATCATAGCAAAAATTGAAAATATAGAAGGTATGGAGAACTTTGAAGAT
ATTTTAAAAAGTTCTGATGGTATTATGGTAGCAAGAGGTGACTTAGGTATGGTCATCCCA
GCATAGAAAGTTTTCGTTGCCTAAAAATGGATGATAGATCGCTGTCTTGAAGTTGGTAAA
CCTGTAATTACTGCAACATAGATGATGGAAAGTATGGTAAAAAATCCAAGACCAACTAGA
GCTGAAGCTAGTGATGTAGCTAATGCAGTTTTAGATGGCACAGATGCTGTCATGCTATCT
ACAGAAACATCTGTAGGGTAATATCCTTGTGAATGTGTCGAAATTACCTCTTAAATTGCT
AGAGAAGCAGAAATGTGTTACAATAATGCAGACAACTTTTTCAAAAGAACAAAACTGATA
AGAGAAATTTCTGACACTGAGAGTATGGCAACTAGTGCAGTATAAATGAGTTTTGATTTA
AAAGCACCTATTATTGTTGTTTTTACAATGTATGGAGAGATGGCTAGATTAATATCTAAA
TATAGACCAACAGCTCACGTGATTGTTGTAAGCAATGAACCTGGAACAATCAAAGCTTTA
ACCTTAAGCCATGGCATTATTAGTCTCAAAGTTCCTTCGTTTTAAGGTATTGAAAAGCTT
ATAGATTATGCTATCAATCGTGCTAAAGAATTAAATTTATGTAAGAAGGGGAATAAAGTT
ATAGTCGTAATGGGAAGTGAAGAAGAGGATTAAGATTAAAGTGATATCTTAAAAGTAAAA
ACTGTGTCATGA


>TTHERM_00145990(protein)
MSQILRYQGKLIQYRKIQFTIKNLQYLYQSECLKITISQNINQVNLYYVYSELSKQIQTQ
NQIYISKQLKVIANHNTIFKIAKADQRMNTFGQNFNLNKVLKETDYSKRKTKIVCTLGPQ
SSSVEMICKLLDSGMNVARITYCHGLKQFYETVISNLKQAFKLRKSIQCSIMLDTRGPDI
RTSLLKDKKPIEIKKGQKLKIMDEQPEYEGDEQGIGCSIALSKLVQVGQHVLLSDNTIYS
HVVEVNESDIVVQFENEGILNEVKNVRLPGVKIDLPTISEEDEDFIISQGLEKGVDFIAV
SFVRSGEDIEYVRDLLSPRGEHIKIIAKIENIEGMENFEDILKSSDGIMVARGDLGMVIP
AQKVFVAQKWMIDRCLEVGKPVITATQMMESMVKNPRPTRAEASDVANAVLDGTDAVMLS
TETSVGQYPCECVEITSQIAREAEMCYNNADNFFKRTKLIREISDTESMATSAVQMSFDL
KAPIIVVFTMYGEMARLISKYRPTAHVIVVSNEPGTIKALTLSHGIISLKVPSFQGIEKL
IDYAINRAKELNLCKKGNKVIVVMGSEEEDQDQSDILKVKTVS


>TTHERM_00145990(gene)
ATGTCATAAATCCTAAGATACCAAGGCAAATTGATCTAATATAGGAAGATTTAATTTACT
ATTAAAAATTTGTAATACTTATATTAAAGTGAATGTTTAAAGATTACTATATCATAAAAT
ATTAATTAAGTAAATCTATATTACGTATACAGTGAATTATCTAAACAGATATAAACGCAA
AACTAAATATATATTTCAAAATAATTAAAAGTTATAGCAAATCATAACACTATTTTTAAG
ATAGCTAAGGCAGACCAAAGTAGATTTTATTCCACATTGCAAAATAGAAATAGTTTTTTA
CATTTTAAAATAGATATAGAATTCAATAAAAGGAATGAACACATTTGGATAAAATTTCAA
TTTAAATAAGGTTTTAAAGGAAACTGATTACTCAAAAAGAAAAACCAAAATAGTTTGTAC
ATTAGGGTAATTATTATAAATATATTAAAATAAAAATAGATCGACATATAATAAATTATG
CAATTATTTATTTCTAAATAGCCCTTAAAGCTCTAGTGTAGAAATGATATGCAAGCTTCT
TGATTCAGGAATGAATGTTGCAAGAATTACTTATTGTCATGGATTAAAGCAAGTAAATTT
GATAAATTTATTATAAAATGTGAACTCAAGGATTAATTGAATAGTTTTAAAAAAAAATAT
TTCCTTAAAATAAGTTTGTTATTTTATTTAAATAATATTTTCATTTAAAATAGTTTTATG
AAACAGTAATTAGCAATTTGAAATAAGCATTCAAACTCAGAAAAAGCATTCAATGTTCTA
TTATGTTAGATACAAGGGTAGAAATATATTTAACATTTTGATAATTTATCAATAAATAAA
TAAAAATAAAAATGATTATTTTAAAATGAACATATTTGGTATTTATTCTTATTCAAAAAT
ATTTAATGTAGGGTCCAGATATTAGAACTTCTTTACTAAAGGATAAAAAACCTATTGAAA
TAAAGAAAGGATAAAAATTAAAAATAAGTAAGCAAGTCTTTTATAAATTATCTTCTTACT
TTTAATAGAATATAATATCATAACAGTAATCTGATAAATTAGATGAACTATTTATTATAA
TAGTTTTTATGGCTTCAAATGGTCTTTCTTAGCATTATATTACTAAAAAATAGAAAATAA
AATAATTGAAAATATATTTTTTTAAATTAAGTCACAGCAACTTATTTTTTCCAACTTTAT
ATTGAATACTAAATTGCAAACTTGCAATTTTATTAACAGCTTTTAATAGATTTTTAATAT
AAAAAGTGGATGAGCAGCCAGAATATGAAGGAGATGAGTAAGGGATAGGTTGTTCTATAG
CTCTTTCAAAATTAGTTTAAGTTGGATAACATGTGTTATTATCAGATAATACAATATATT
CTCATGTTGTTGAAGTAAATGAGGTAAACATTACTTTACTCTTTTTTATTTTAATAAACT
TAATTTACTTACACTTTTACATAAAAAATGAATTCATTAATTAGCATAAAAGCTAAACAA
AATATTAATTATTAAATTAAAATTAATTTATTTTTAATAAATAAAAGTCTGATATTGTTG
TCTAGTTTGAAAATGAGGGAATTTTAAACGAAGTAAAAAATGTAAGACTTCCAGGTGTTA
AAATAGATTTGCCAACAATAAGTGAAGAAGGTATTTTCATAATACAATTTAAAAATGATT
AATAATTTTAATTAATACTAATAGATGAAGATTTTATCATTTCATAAGGATTAGAAAAAG
GTGTAGATTTTATAGCTGTATCTTTCGTACGTAGTGGGGAAGATATTGAATATGTAAGAG
ATCTTTTATCTCCTAGAGGGGAGCATATTAAAATCATAGCAAAAATTGAAAATATAGAAG
GTATGGAGAACTTTGAAGATATTTTAAAAAGTTCTGATGGTATTATGGTAGCAAGGTATG
TATAATCATTAATACTATTAATTTATTTTGTTTGTAATAAATTAAATCGACTAAGCAGTT
TAATTATTTAGTTAATTGTTTAATTATTTATTTATTTTAAGGTTTTATTTAAATCTTAGC
ATGAAAAAATGATCATTTATTAATTTTAAATAAAGCTTAATTTAAGATTTTATTTTAATC
TAGGCATGAAAAGTAAATTCTTTATTAATTTTTATTTTTTTAAATAAAAGAGGTGACTTA
GGTATGGTCATCCCAGCATAGAAAGTTTTCGTTGCCTAAAAATGGATGATAGATCGCTGT
CTTGAAGTAAATATAATATTTTGAATGTTATATAATTGCTCATTTTAATATAAAAAGGTT
GGTAAACCTGTAATTACTGCAACATAGATGATGGAAAGTATGGTAAAAAATCCAAGACCA
ACTAGAGCTGAAGCTAGTGATGTAGCTAATGCAGTTTTAGATGGCACAGATGCTGTCATG
CTATCTACAGAAACATCTGTAGGGTAATATCCTTGTGAATGTGTCGAAATTACCTCTTAA
ATTGCTAGAGAAGCAGAAATGTGTTACAATAATGCAGACAACTTTTTCAAAAGAACAAAA
CTGATAAGGTCAATATAATAAATATAAAAGAAATTAAATTTTTCCTTCATTTAAACTTTA
TTTTAAAATAAAATATTTAATTAAAAGAAATTTTTTTTTAAGTAATTTGATATCCAATTT
TATAAAATTAGAGAAATTTCTGACACTGAGAGTATGGCAACTAGTGCAGTATAAATGAGT
TTTGATTTAAAAGCACCTATTATTGTTGTTTTTACAATGTATGGAGAGATGGCTAGATTA
ATATCTAAATATAGACCAACAGCTCACGTGATTGTTGTAAGCAATGAACCTGGAACAATC
AAAGCTTTAACCTTAAGCCATGGCATTATTAGTCTCAAAGTTCCTTCGTTTTAAGGTTAC
ATTTTATTTTCTATATTCTATGAAAAATATTTTGAATATCTTGTTAATAATTCAACTCTT
AAAATTTAGGTATTGAAAAGCTTATAGATTATGCTATCAATCGTGCTAAAGAATTAAATT
TATGTAAGAAGGGGAATAAAGTTATAGTCGTAATGGGAAGTGAAGAAGAGGATTAAGATT
AAAGTGATATCTTAAAAGTAAAAACTGTGTCATGA