Identifiers and Description

Gene Model Identifier

TTHERM_00118600

Standard Name

PYK1 (PYruvate Kinase)

Aliases

PreTt27179 | 8.m00439 | 3812.m02471

Description

pyruvate kinase; converts phosphoenolpyruvate to pyruvate during glycolysis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00118600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_66110
Tetrahymena borealisEI9_03875.19.997093137033517e-262pyruvate kinase (475 aa)
OxytrichaContig18083.0.g1149.997093137033517e-262Pyruvate kinase, barrel domain
DictyBaseDDB_G02832474.998226778107862e-142pyk on chromosome: 4 position
344914 to 346711
WormBaseWBGene000140018.997006431083756e-128locus:pyk-2 Pyruvate kinase
status:Confirmed UniProt:Q
23539 protein_id:CAA93424.2
SGDYAL038W1.9994050701445255e-104CDC19 Pyruvate kinase, functio
ns as a homotetramer in glycol
ysis to convert phosphoenolpyr
uvate to pyruvate, the input f
or aerobic (TCA cycle) or anae
robic (glucose fermentation) r
espiration

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00118600(coding)
ATGGACTCAAGCTACTCTGAATTCACTCTTGATGGTATTCTCTCCCACACTGACTACTCC
AAGAGAAAGACCAAAATTGTCTGCACTATTGGACCCTCTTGTTGGGATCACGATAATCTC
GTTTAATTGCTTGAAAATGGTATGAATGTTGCTCGTTTGAACTTCTCCCATGGTGATCAC
GCTGGTCATGGAGAAACTGTTAGAAGACTTAAGGAAGCCTTCAAAGCCAGAAAGAACATT
CAATGTGCTCTTATGCTTGATACTAAAGGACCAGAAATCAGAACTGGTTTGGTAAAAGAC
TAAACTAAGAAGCTCATCAACCTCGTTGCTGGATAAGAATTAGAAATAACTACTGACTAT
AGCGTTTTAGGAGATGAGAAAGTTCTTGCTTGCTCTTACAAAAGTTTACCCAAGAGTGTC
AAAGTTGGTGGTTAAGTCTTGATAGCCGATGGTACTTTGGTTTGCATAGTTAAGGAAATC
AAATAGGACAGTATCATCGTAAATGTTTAAAATACCTGCAGTATTGGTGAAAAGAAGAAT
ATGAATTTACCAGGTGCTATTGTTGATCTCCCTACAGTCACTGAAAAAGACGAAGATGAT
ATTGTTAACTTCGGTCTTAAGCATGGTATTGATTGTATTGCCTTGTCCTTCGCCAGAAAA
GCTGAAGATATTGAATACGTTAGAGATATCTTGGGACCTCAAGGTGAACACATTAAGATC
ATTGCAAAGATTGAAAACCAAGAAGGTCTTCATAATTATGAATAAATTTTAGATGCTGCC
GATGGTATCATGGTTGCTCGTGGTGATTTAGGTATGGAAATCCCTCCTTAGAAGGTCTTC
GTAGCTCAAAAATGGATGATCCGCAAAGCCCTTGAAAAAGGTAAACCCATTATTACTGCT
ACCTAAATGATGGAAAGTATGATTAAAAATCCCAGACCTACTAGAGCTGAAGCCAGTGAT
GTTGCTAATGCAGTTTTGGATGGTACTGATGCAGTTATGCTTTCAGGTGAAACCGCTAAC
GGATCTTTCCCTATTCAAGCTGTCTAAACCATGGCTTACATTTGCTCAGAGGCCGAACTT
TGCTATGACAACAGACAAACTTTCTGGTAAAGAACAAACAACAAGAAAAAAGTTTCTGCT
GTTGAATCTATGGCTATCTCTGCTGTCTAAATGAGTTTTGAAATTGAAAGTCCTGTTATC
ATCGTATTTACTACTAATGGTGATATGGCTAGATATGTCTCCAAGTACAGACCAAGTGCT
TAAATTTTCGTTGTATCAACTGAAAACGGTACAATTAAAGGCCTTTGCACTACTTTTGGT
GTCAGATGCTTAAGAGTCCCTTCATTCTAAGGTATTAATAAGCTCATTGATTATGCTGTT
GATGCTGCTAAAGAGTAAGGATTTATCAAGTCAGGATAAAATGCAATTGTAATCCTTGGC
TCAAACGAAGAAGAACCTGATCAAGGTGACATCCTTAAAATCAAGGAAGTTAAATGA


>TTHERM_00118600(protein)
MDSSYSEFTLDGILSHTDYSKRKTKIVCTIGPSCWDHDNLVQLLENGMNVARLNFSHGDH
AGHGETVRRLKEAFKARKNIQCALMLDTKGPEIRTGLVKDQTKKLINLVAGQELEITTDY
SVLGDEKVLACSYKSLPKSVKVGGQVLIADGTLVCIVKEIKQDSIIVNVQNTCSIGEKKN
MNLPGAIVDLPTVTEKDEDDIVNFGLKHGIDCIALSFARKAEDIEYVRDILGPQGEHIKI
IAKIENQEGLHNYEQILDAADGIMVARGDLGMEIPPQKVFVAQKWMIRKALEKGKPIITA
TQMMESMIKNPRPTRAEASDVANAVLDGTDAVMLSGETANGSFPIQAVQTMAYICSEAEL
CYDNRQTFWQRTNNKKKVSAVESMAISAVQMSFEIESPVIIVFTTNGDMARYVSKYRPSA
QIFVVSTENGTIKGLCTTFGVRCLRVPSFQGINKLIDYAVDAAKEQGFIKSGQNAIVILG
SNEEEPDQGDILKIKEVK


>TTHERM_00118600(gene)
ATGGACTCAAGCTACTCTGAATTCACTCTTGATGGTATTCTCTCCCACACTGACTACTCC
AAGAGAAAGACCAAAATTGTCTGCACTATTGGGTAACCAGCAAATCAATTTTATATTATT
CATATATCTTTTGACATCCTTTCATGATTGTGTTTGCTAACAATTTGTTTTAATAATATA
GACCCTCTTGTTGGGATCACGATAATCTCGTTTAATTGCTTGAAAATGGTATGAATGTTG
CTCGTTTGAACTTCTCCCATGGTGATCACGCTGTAAGCTTCTAAAATATATTATTATTTT
GCAAAAAAGCACAATTTCAAGCTTATTAAATGACATTTTTGCTTACTATCTCCCATATTT
TAATCATAATAGGGTCATGGAGAAACTGTTAGAAGACTTAAGGAAGCCTTCAAAGCCAGA
AAGAACATTCAATGTGCTCTTATGCTTGATACTAAAGTACGTCATATTTTATACTTCACA
GCCCTTTAATAGCCCTAAAATTAATATTTTCAAAAGATTTCAATCAATTTTTTTCTAAAT
TATACTATTTATAATCTAAAAGGGACCAGAAATCAGAACTGGTTTGGTAAAAGACTAAAC
TAAGAAGCTCATCAACCTCGTTGCTGGATAAGAATTAGAAATAAGTAAAGCTTAGTATTA
AGTATTAATGAAATAAATATCATTTTTCTTTTTTAATTGTAATTTTCTAGCTACTGACTA
TAGCGTTTTAGGAGATGAGAAAGTTCTTGCTTGCTCTTACAAAAGTTTACCCAAGAGTGT
CAAAGTTGGTGGTTAAGTCTTGATAGCCGATGGTACTTTGGTTTGCATAGTTAAGGAAAT
CAAATAGGTAAAATATTAATTAGTCTTATTTAAAAAAACGTTTTTTATTTGCGAAACAAA
CAACAACAATAATAAAAATAAATAAGCATAAAGAAACTGATAGAACTTTTTAATGAAAAT
AAATAAAGAGTTTGTTTTTTATCTATAATCAGAGATAGTTAATTAATTTAAAATAAAAGC
CAAATCAATAAAAATACAATTTATTTATTGTTGGTTATTAAATTTTGATTCTGATCACAA
AAAAATTAATTATAAAAATATTTACAAAGCAAGATATTAAACTTAATTTATTGAGAATAA
TCAATCCCACTTAATAATTATTAATGCTTTAATGAATGAATGCAATTAATTTCTTCTTTT
TAACAATACAATAGGACAGTATCATCGTAAATGTTTAAAATACCTGCAGTATTGGTGAAA
AGAAGAATATGAATTTACCAGGTGCTATTGTTGATCTCCCTACAGTCACTGAAAAAGACG
AAGATGATATTGTTAACTTCGGTCTTAAGCATGGTATTGATTGTATTGCCTTGTCCTTCG
CCAGAAAAGCTGAAGATATTGAATACGTTAGAGATATCTTGGGACCTCAAGGTGAACACA
TTAAGATCATTGCAAAGATTGAAAACCAAGAAGGTCTTCATAATTATGAATAAATTTTAG
ATGCTGCCGATGGTATCATGGTTGCTCGTGGTGATTTAGGTATGGAAATCCCTCCTTAGA
AGGTCTTCGTAGCTCAAAAATGGATGATCCGCAAAGCCCTTGAAGTAATTTTAATACTAC
CTATCTATTTACTAATTTATTTTCTAATAAACAGAAAGGTAAACCCATTATTACTGCTAC
CTAAATGATGGAAAGTATGATTAAAAATCCCAGACCTACTAGAGCTGAAGCCAGTGATGT
TGCTAATGCAGTTTTGGATGGTACTGATGCAGTTATGCTTTCAGGTGAAACCGCTAACGG
ATCTTTCCCTATTCAAGCTGTCTAAACCATGGCTTACATTTGCTCAGAGGCCGAACTTTG
CTATGACAACAGACAAACTTTCTGGTAAAGAACAAACAACAAGGTATTTATTTTTATTTT
ATAGAATTAAAAATAAAATTTAGATAAGATTAACATACAAAAAGGATTTTTATCAAAATA
AAGAAAGATACAATTTGCAAATTTATTTTAGTTAGATATTATTAAACAAACTTGAATTAT
TTGTTTAGCATAAATAACATAAACATTATTTACAAAGCTAACACAAAATATTTATGATAT
ATAAAGATTCTTAAAATTAATATTTTTATGTTAAATTAATATTAAAAATAGAAAAAAGTT
TCTGCTGTTGAATCTATGGCTATCTCTGCTGTCTAAATGAGTTTTGAAATTGAAAGTCCT
GTTATCATCGTATTTACTACTAATGGTGATATGGCTAGATATGTCTCCAAGTACAGACCA
AGTGCTTAAATTTTCGTTGTATCAACTGAAAACGGTACAATTAAAGGCCTTTGCACTACT
TTTGGTGTCAGATGCTTAAGAGTCCCTTCATTCTAAGGTGAAAATTACTATTTTAACTGT
AAAATAAATATTAACTATATTCATATTAATAGGTATTAATAAGCTCATTGATTATGCTGT
TGATGCTGCTAAAGAGTAAGGATTTATCAAGTCAGGATAAAATGCAATTGTAATCCTTGG
CTCAAACGAAGAAGAACCTGATCAAGGTGACATCCTTAAAATCAAGGAAGTTAAATGA