Identifiers and Description

Gene Model Identifier

TTHERM_00590030

Standard Name

PWP1 (periodic tryptophan protein 1)

Aliases

PreTt24118 | 81.m00175 | 3726.m00051

Description

Protein with WD-40 repeats involved in rRNA processing

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.9%

TetraMine Data

TTHERM_00590030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16946.19.997093137033517e-262hypothetical protein (494 aa)
OxytrichaContig7752.0.g107.0000984021781654e-99WD domain, G-beta repeat
DictyBaseDDB_G02750731.0001267035975107e-72pwp1 on chromosome: 2 position
5128411 to 5130120
WormBaseWBGene000104351.000499495426459e-47status:Partially_confirmed U
niProt:Q9NAQ2 protein_id:CAB
05230.3
SGDYLR196W4.000820122464668e-47PWP1 Protein with WD-40 repeat
s involved in rRNA processing;
associates with trans-acting
ribosome biogenesis factors; s
imilar to beta-transducin supe
rfamily
Stentor CoeruleusSteCoe_75771.1089390193121365e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00590030(coding)
ATGGATTAAAACGTTGTAAGTTCTTTAGTTTGGGTTAAGAGAGGTTTTGCTAAGGCAAAC
CCTATTGAATTCGAAATGAATGAATAAGATGTTAATGAAATGAAAAAAGATCCTTTGGTC
AAAAAGAACGCTAATAGGGAATTAGGTAAGGAAATTGAGGATGAAAATGAGTTTGAAGAT
GTTGATGATGACGATGAAGAAGAAAACTTGCCAGTATTTGCTTAAGAAATTGAAATGCTT
AAAAACGAAAACATGGTCGACCAAGATGGTAATCCTCTAGGCTTTGATGAAATGTCTGAA
GAAGAAAAAGAAGATTTTTAAATTAAGCCAAACGATGCACTTATTGTAGCTGCTAAAATT
GAAAAGGAATTTTCAAGCTTAGAAGTTTATGTTTATGAAGAAGACAGAAACAACTTGTTT
GTTCATCACGAAATTTAATTGTCTGCTTTCCCTCTTTGCCTTGAATGGTTGAGAGTTGAT
CCTTCCTCATTTGATGCTTCAGTTTAAAAACCTGGAAATTTTGCAATCGTTGGATCTTTC
TTACCTGAAATTGAAGTATGGAATCTCGATGTTTTAAATATTATTGAACCTACTTTTACT
CTTGGTGGTGAAGTTTAATAAAATTCCAAGAAAGTTAAGAAGTTTAAAAAGCCTAAATAA
CAATTGAAGCCTGGCAGTCACGCAGATGCAGTTTTATCTCTTAACATTAATCCATTCAGA
CAAAATGTCTTAGCTTCAGGTTCTGCTGATAATACAGTTAAGATTTGGGATCTTGGCTAA
CAAAAGAACATTTTTACATACACTCATCACACAAACAAAGTTCAAGTAGTTTCATGGAAT
AAACAAGAAGAATCTATTTTGTTATCAGGAGGCTATGACAGAAAAATCTGCATGTTCGAT
GTCAAAAATCCTTAAAATATATTAAGTTGCAAAATTTAATCAGATATTGAAAGTGCCATT
TGGGATCCTACTAATTCTAATTAAATTATTTTCTCAACTGAAGATGGATATGTTTCTTGC
ATTGATGCTAGAAAGTTCAATTTAGATTACTTATTCCACTTTTAGAGCCATGAAAAATCT
ACTACTAGTGTTAGTATGAGTCCTAAAGTTGGAGGTATGCTTGCCACCACTTCAATTGAT
CATTCAGTTAAAATTTGGGATATCACTCAAATCACTAATAAAAGACCTAAATTAGTTTCA
TAAAAAAATCCTTCAGCAGGTAAATTATTCTGCGGAAGTTTCTATGAAGATTCTCCTTTC
GTTTTTGGCTGTGGTAACTCCAAGGGTGAAATTTTCATTTGGGATACTACTGAAGATAAA
AATATAGTTGAATGCTTCGGAAGCAGAGTTGAAGCTAAATACTAACCAAATATCAGTTTA
TGTACTAAGGATGGTGAAAAGAATTACTTCACTAAAGAAGGAAGAGATGAAGATGATGAT
GAAGCAGACGAAATGGAATAAGAAAATGAAGATATGGTTTGA


>TTHERM_00590030(protein)
MDQNVVSSLVWVKRGFAKANPIEFEMNEQDVNEMKKDPLVKKNANRELGKEIEDENEFED
VDDDDEEENLPVFAQEIEMLKNENMVDQDGNPLGFDEMSEEEKEDFQIKPNDALIVAAKI
EKEFSSLEVYVYEEDRNNLFVHHEIQLSAFPLCLEWLRVDPSSFDASVQKPGNFAIVGSF
LPEIEVWNLDVLNIIEPTFTLGGEVQQNSKKVKKFKKPKQQLKPGSHADAVLSLNINPFR
QNVLASGSADNTVKIWDLGQQKNIFTYTHHTNKVQVVSWNKQEESILLSGGYDRKICMFD
VKNPQNILSCKIQSDIESAIWDPTNSNQIIFSTEDGYVSCIDARKFNLDYLFHFQSHEKS
TTSVSMSPKVGGMLATTSIDHSVKIWDITQITNKRPKLVSQKNPSAGKLFCGSFYEDSPF
VFGCGNSKGEIFIWDTTEDKNIVECFGSRVEAKYQPNISLCTKDGEKNYFTKEGRDEDDD
EADEMEQENEDMV


>TTHERM_00590030(gene)
ATGGATTAAAACGTTGTAAGTTCTTTAGTTTGGGTTAAGAGAGGTTTTGCTAAGGCAAAC
CCTATTGAATTCGAAATGAATGAATAAGATGTTAATGAAATGAAAAAAGATCCTTTGGTC
AAAAAGAAGTACATACAAATATTTCTTTCACAAACATATTTTTTAAGGTTCTAATATATT
ATCATTAAATAGCGCTAATAGGGAATTAGGTAAGGAAATTGAGGATGAAAATGAGTTTGA
AGATGTTGATGATGACGATGAAGAAGAAAGTAATTAACTAATAAATAAATTATTATGATA
ATTGCAAGCACCTTAAATTTTAAAAATGCTAATTTTAAATATTTTATAAATTTTGTAGAC
TTGCCAGTATTTGCTTAAGAAATTGAAATGCTTAAAAACGAAAACATGGTCGACCAAGAT
GGTAATCCTCTAGTAAAAAATTATTTATTTTGCATATTTACATTATTCTACTGAGTATAG
TAATAAAATAAATGTTCTACACCAGTCAATCCAAATCAAATGAAGAGTTATATTTAATTT
CATTCATAAAAATAAAGGGCTTTGATGAAATGTCTGAAGAAGAAAAAGAAGATTTTTAAA
TTAAGCCAAACGATGCACTTATTGTAGCTGCTAAAATTGTAATTAATATATTTCAAGCAT
TTTTCAAAGTTCTAGTTAGTTATATTAATCCTTATCAATAATCAAAATAGGAAAAGGAAT
TTTCAAGCTTAGAAGTTTATGTTTATGAAGAAGACAGAAACAACTTGTTTGTTCATCACG
AAATTTAATTGTCTGCTTTCCCTCTTTGCCTTGAATGGTTGAGAGTTGATCCTTCCTCAT
TTGATGCTTCAGTTTAAAAACCTGGTATTAATATATAAATAGATTTTTTCAATAAATAAA
TAGATAGATAGATATCTCTACTTATTGTCATAGATTTAAATTAATTAATAATTTTGTTAA
CAAAAAAAGGAAATTTTGCAATCGTTGGATCTTTCTTACCTGAAATTGAAGTATGGAATC
TCGATGTTTTAAATATTATTGAACCTACTTTTACTCTTGGTGGTGAAGTTTAATAAAATT
CCAAGAAAGTTAAGAAGTTTAAAAAGCCTAAATAACAATTGAAGCCTGGCAGTCACGCAG
ATGCAGTTTTATCTCTTAACATTAATCCATTCAGACAGTAATCATTTATTATTTGATATA
TTTTCAATATTCTTATATTAATTTTATCAATAAAACAAAAAGAAATGTCTTAGCTTCAGG
TTCTGCTGATAATACAGTTAAGATTTGGGATCTTGGCTAACAAAAGAACATTTTTACATA
CACTCATCACACAAACAAAGTAAAAAATCAATAATTTTTAACTATTTAGCTGGACCATAT
TTAATTCAAAAGTTCTTTATGATAAATAGACTTTATTAACTTTAGTTTATTTTACAAGTT
TTAGCGCCTTACTTATATTTTATCAATTAAATTTATTTTAATAACTCATTTTGAAGCATT
AAATGAAGTTTTTTTATTTAATTAAAGGTTCAAGTAGTTTCATGGAATAAACAAGAAGAA
TCTATTTTGTTATCAGGAGGCTATGACAGAAAAATCTGCATGTTCGATGTCAAAAATCCT
TAAAATATAGTAATTAATTAATTAAAATTAAAGTTAGATTAAAATTAAATTAAAAAATTA
GTTAAGTTGCAAAATTTAATCAGATATTGAAAGTGCCATTTGGGATCCTACTAATTCTAA
TTAAATTATTTTCTCAACTGAAGATGGATATGTTTCTTGCATTGATGCTAGAAAGTTCAA
TTTAGATTACTTATTCCACTTTTAGAGCCATGAAAAATCTACTACTAGTGTTAGTATGAG
TCCTAAAGTTGGAGGTATGCTTGCCACCACTTCAATTGATCATTCAGTTAAAATTTGGGA
TATCACTCAAATCACTAATAAAAGACCTAAATTAGTTTCATAAAAAAATCCTTCAGCAGT
AATTTTAATTTAAGTTTATTTGAAAAGGAATTAAATGCTCATTTGTTAAATCATAAAATT
AGGGTAAATTATTCTGCGGAAGTTTCTATGAAGATTCTCCTTTCGTTTTTGGCTGTGGTA
ACTCCAAGGGTGAAATTTTCATTTGGGATACTACTGAAGATAAAAATATAGTTGAATGCT
TCGGAAGCAGAGTTGAAGCTAAATACTAACCAAATATCAGTTTAGTAATAAATTAATACA
AATGTTAATAAATAAATAATTTAATTTAATTTATAAAATAGTGTACTAAGGATGGTGAAA
AGAATTACTTCACTAAAGAAGGAAGAGATGAAGATGATGATGAAGCAGACGAAATGGAAT
AAGAAAATGAAGATATGGTTTGA