Identifiers and Description

Gene Model Identifier

TTHERM_00181100

Standard Name

PUS3 (PseudoUridine Synthase)

Aliases

PreTt29828 | 14.m00395 | DEG1

Description

tRNA pseudouridine synthase A family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01416 ) tRNA pseudouridine synthase
  • ( TIGR00071 ) tRNA pseudouridine synthase A

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00181100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09939.19.997093137033517e-262tRNA pseudouridine synthase A
family protein (498 aa)
DictyBaseDDB_G02889092.998830401637127e-79pus3 on chromosome: 5 position
2110038 to 2111898
WormBaseWBGene000064737.002037867398653e-67locus:tag-124 Probable tRNA
pseudouridine synthase tag-124
status:Confirmed UniProt:
Q09524 protein_id:CAA87378.1
SGDYFL001W6.997942222381785e-66DEG1 tRNA:pseudouridine syntha
se, introduces pseudouridines
at position 38 or 39 in tRNA,
important for maintenance of t
ranslation efficiency and norm
al cell growth, localizes to b
oth the nucleus and cytoplasm;
non-essential for viability
OxytrichaContig18928.0.g261.9997677415930956e-65tRNA pseudouridine synthase
Stentor CoeruleusSteCoe_323531.603810890548638e-28

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00181100(coding)
ATGGATACAATTTAATAAAGCGAATAAGGAAATATACAAATATCTTAAGAAGGCCAAAGT
GAATAGAAAGCTAACTAAGATATTAAAAAAGATGAAGAGCAAAAAAGCGAGTCATTAGAA
AGTGAAGACTTAGATAAATTTTCTAAGGAAGAAATCATTAAAAAATATTTGTTCATAAAA
AAGGAAAATTAAGTTTTAAGAAAATAATTAAACCATAACAACGACACAAAAGCCCCTATT
CCTAATAATAGCTCTTAAAATGAGACTAAAAAGTAAAAGAAAGAGCAAAAATAGAATAAC
AAAAAGGAAAGCCTATTCGAAATCTACCAATAACAGCATTATGCCTTAAAAATGTCTTAT
GTTGGAATCAATTATCAAGGCTTAGCATATTAGTAAGAAACTGACAACACTGTAGAAGAA
TAGCTCTTCAAGGCACTTGAAAAGACAACACTGATAAAAAATAGAGATAATTGCAATTTC
ACACGTTCAGGAAGAACTGACAAAGGAGTTAGTGCTTTAGGATAAGTTATTGGTATCACT
CTTAGAACTTCAATAAAAATAGGTGAAAATATTGATGAAATAGAAAATAAATTAGATTAC
ATTAAGATGCTTAATAGTAATCTTCCAGACGACATAAGGATTTTAGGTTGTTCTAAAGTT
GATCCTGCTTTTAATGCAAGATTTGATTGTTAAAAGAGAATTTATAAGTATTACTTTTTT
GAGAATTAGATGGATATTTAAAGAATGAAGGAAGCAGCTAACCTCTTTTTGGGAGAACAC
GATTTTAGAAATTTCTGCAAAATAGATGTTTTGCAAACACTTAACTATGTTAGAATTATT
TATTAACTTGATATAGAAGAAGTTTAGGCTAATTTTGGTACTCTTGACCCTCGTTCTAAA
TTATATGTAGCAACTATTCAAGGAAGTGCTTTCCTTTGGCATTAAATCAGAAACATGATG
GCTATACTTTTTCTAGTAGGCAGAAAATAAGAAGAACCTTCAATAGTTACAGAGCTTCTT
GATATTTAAAAGAATCCATCTAAACCTAATTATGAGATGGCTCCTGATTATCCTCTAGTA
TTATTTGATTGCTTGTACAATAATGTTAGTTTTAACTACAGTAGCGATTAGATAAAGATT
TATGAACATTATTTGCAGATAATCTAAAAAAAGTGTATCGAAAATTAGCTTTATATTACA
ACTCTCAATTATATGGCATAAACTGCTTAGCAATTTAACAATTATAATCTTATTTAAAAT
TCATTGATTTCAGAAGAAGCTACTCTTCGTAATAAGAAATACTAGCATCTTTCAAAAAGA
TAATGTGCTTAATCATCAGAAGACACTTTAAAAAATTTAAAAGGCAGAAAATTAGATAAG
TTTTTAATTAAGCAAGAAAAATAGATAAATTATTAATAGTAGCGCGAAGCAGAAAAGAAT
TTATCATAAACATAAGATTAAACCTCTGAAGGAAACGATACTTAAGAATGA


>TTHERM_00181100(protein)
MDTIQQSEQGNIQISQEGQSEQKANQDIKKDEEQKSESLESEDLDKFSKEEIIKKYLFIK
KENQVLRKQLNHNNDTKAPIPNNSSQNETKKQKKEQKQNNKKESLFEIYQQQHYALKMSY
VGINYQGLAYQQETDNTVEEQLFKALEKTTLIKNRDNCNFTRSGRTDKGVSALGQVIGIT
LRTSIKIGENIDEIENKLDYIKMLNSNLPDDIRILGCSKVDPAFNARFDCQKRIYKYYFF
ENQMDIQRMKEAANLFLGEHDFRNFCKIDVLQTLNYVRIIYQLDIEEVQANFGTLDPRSK
LYVATIQGSAFLWHQIRNMMAILFLVGRKQEEPSIVTELLDIQKNPSKPNYEMAPDYPLV
LFDCLYNNVSFNYSSDQIKIYEHYLQIIQKKCIENQLYITTLNYMAQTAQQFNNYNLIQN
SLISEEATLRNKKYQHLSKRQCAQSSEDTLKNLKGRKLDKFLIKQEKQINYQQQREAEKN
LSQTQDQTSEGNDTQE


>TTHERM_00181100(gene)
AAAGCTTGTGGGCTCAAATTAATAAAATTTATTAATTCTAATTAAAAAAAGTAGTTTGAT
TTATAGAGAATGGATACAATTTAATAAAGCGAATAAGGAAATATACAAATATCTTAAGAA
GGCCAAAGTGAATAGAAAGCTAACTAAGATATTAAAAAAGATGAAGAGCAAAAAAGCGAG
TCATTAGAAAGTGAAGACTTAGATAAATTTTCTAAGGAAGAAATCATTAAAAAATATTTG
TTCATAAAAAAGGAAAATTAAGTTTTAAGAAAATAATTAAACCATAACAACGACACAAAA
GCCCCTATTCCTAATAATAGCTCTTAAAATGAGACTAAAAAGTAAAAGAAAGAGCAAAAA
TAGAATAACAAAAAGGAAAGCCTATTCGAAATCTACCAATAACAGCATTATGCCTTAAAA
ATGTCTTATGTTGGAATCAATTATCAAGGCTTAGCATATTAGTAAGAAACTGACAACACT
GTAGAAGAATAGCTCTTCAAGGCACTTGAAAAGACAACACTGATAAAAAATAGAGATAAT
TGCAATTTCACACGTTCAGGAAGAACTGACAAAGGAGTTAGTGCTTTAGGATAAGTTATT
GGTATCACTCTTAGAACTTCAATAAAAATAGGTGAAAATATTGATGAAATAGGTAATATT
AATTAAGTTAGTCTATATTATATATAAATATTTATTTATTATTTACTTTGATAGAAATAA
CAATTTTAAAATATTTATTTTTTACAATGTGATAGAAAATAAATTAGATTACATTAAGAT
GCTTAATAGTAATCTTCCAGACGACATAAGGATTTTAGGTTGTTCTAAAGTTGATCCTGC
TTTTAATGCAAGATTTGATTGTTAAAAGAGAATTTATAAGTATTACTTTTTTGAGAATTA
GATGGATATTTAAAGAATGAAGGAAGCAGCTAACCTCTTTTTGGGAGAACACGATTTTAG
AAATTTCTGCAAAATAGATGTTTTGCAAACACTTAACTATGTTAGAATTATTTATTAACT
TGATATAGAAGAAGTTTAGGCTAATTTTGGTACTCTTGACCCTCGTTCTAAATTATATGT
AGCAACTATTCAAGGAAGTGCTTTCCTTTGGCATTAAATCAGAAACATGATGGCTATACT
TTTTCTAGTAGGCAGAAAGTAATTATTTAGTTAGAAATTTAGTTTAAATACTTTATGAGT
AATATTTATTATTTTAGATAAGAAGAACCTTCAATAGTTACAGAGCTTCTTGATATTTAA
AAGAATCCATCTAAACCTAATTATGAGATGGCTCCTGATTATCCTCTAGTATTATTTGAT
TGCTTGTACAATAATGTTAGTTTTAACTACAGTAGCGATTAGATAAAGATTTATGAACAT
TATTTGCAGATAATCTAAAAAAAGTGTATCGAAAATTAGCTTTATATTACAACTCTCAAT
TATATGGCATAAACTGCTTAGCAATTTAACAATTATAATCTTATTTAAAATTCATTGATT
TCAGAAGAAGCTACTCTTCGTAATAAGAAATACTAGCATCTTTCAAAAAGATAATGTGCT
TAATCATCAGAAGACACTTTAAAAAATTTAAAAGGCAGAAAATTAGATAAGTTTTTAATT
AAGCAAGAAAAATAGATAAATTATTAATAGTAGCGCGAAGCAGAAAAGAATTTATCATAA
ACATAAGATTAAACCTCTGAAGGAAACGATACTTAAGAATGA