Identifiers and Description

Gene Model Identifier

TTHERM_00011450

Standard Name

PUS1 (PseudoUridine Synthase)

Aliases

PreTt11751 | 1.m00799

Description

tRNA pseudouridine synthase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 16.7%

TetraMine Data

TTHERM_00011450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02803.19.997093137033517e-262tRNA pseudouridine synthase (4
71 aa)
WormBaseWBGene000042481.0002124404074584e-26locus:pus-1 tRNA pseudouridi
ne synthase status:Confirmed
UniProt:Q9XXN0 protein_id
:CAA16518.1
OxytrichaContig20508.0.g592.99851380290819e-19tRNA pseudouridine synthase
DictyBaseDDB_G02909872.999758165421992e-18pus1 on chromosome: 5 position
4857087 to 4859177
Stentor CoeruleusSteCoe_253088.533047625744066e-17
SGDYPL212C0.000000000000020000882446601127PUS1 tRNA:pseudouridine syntha
se, introduces pseudouridines
at positions 26-28, 34-36, 65,
and 67 of tRNA; nuclear prote
in that appears to be involved
in tRNA export; also acts on
U2 snRNA

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00011450(coding)
ATGATTTAAACTAAAAGAAATTTCTTTAAGATCAAAGTAGCAATATTCTTTGGCTATAAT
GGCAAAGGGTACCATGGTTCATAGAGCTAAAAGGACTAAAACATTAAGACTATAGAAAAG
TCATTGTTTGAAGGTTTGATAGACTCTAAATTGATTAGTGAAACACATATGGGAGAGTTA
AAAAAAGCAGGTTGGGGAAGAGGAGCTAGAACTGATAAGGGAGTTCATGCATTATGTAAT
GGCGTTAACGTTAAGTTGGCTATTAGTGAAGAGTACCTTATGAGAGGTAGTCCTCTTAGA
ATGGATGATAAAAATCCTGAAGAAATTTAAAAGGAAATATAAGAAAAAAACGAAATATTA
TTAGAATCTGAACAATATAAAAAACCAGAAGAAAACTCTGGTGAATAATAAAATGCAAAT
GGTAATTAAGCATCTGAAAAAGAAATAAAATCCTAGGCTATAGAAGAAGAAGCTGCTGAT
AATGATTAAGAAATAGCAGAAGAATAGGAAGAATAAAAGGAAGGAGAAAAAAATTTAGAA
GAAAGTAAGAAGGTTGAAGATATGACTGAAGAAGAGAGATAAGAAAGAAGTAGAAGATTA
CAATAAGAGGCTGAAGAAAACAGAAAAAAGAAGGAAGTTAGTAAGGCTCATCACAAATAA
CTGTAAGAATTTGCTAACGAAAGAAGAAAGCATATCGATATAGATAAGATTATAAATGCA
TTAAACAGCAATTTACCAGCAGATATTCGCTGTGTTTCAATTAAACAGGTATCTCGTAAA
TTTGATATTCGTACTCACTGCAAATACAGAGTATACGAATACTTAATGCCTCTTTTTATG
TATCAGAAGTATGATGACATTATAGCAGGTACTCCTATGACAGAAGAATTTGAGTAAAAA
ACCATGTAAAGAGTTTCTACATTAGCTGATAAGTTCAAAGGAACTCATAATTACCACAAT
TACACAAGATAAATGAAAGCAAAAGACCCTCGTTGTATGCGTTATATTTTAGACATGAAA
ACTGAATTAATCACCAACCCTTAAAACGGAATGAAATTCATTAGATTTACTTTAGTAGGA
TAGAGTTTTGTTTATCATTAAATTCGTAAGATGATGGGTATGATTTGCATGATGATTTAG
GAAGACTACCCTGACAACTTTATGGATTCTAGCTTTTTCCATAATGTCATGCGTATTTGG
CTTGCTCCTGCCCATGGTTTATTCCTAAATCGTATGAGATTTGATAGTTACAACAAGAAA
CCTGAAATCCCAGAACCTATTGAATTCGATAAGATTGAAGAAGATCGTTTAAGAGAAATG
AGAGATATTATTGAAAAAGCAGTCATGAACGAAGAGGATGTTAATGCAATTTACAAATAA
TGGATTAAAGATGTCAAAGCAGGAAACGAGCTTGCTGAAGAAAATGAATCTGTTTCAGGA
GATATGGATCAATGA


>TTHERM_00011450(protein)
MIQTKRNFFKIKVAIFFGYNGKGYHGSQSQKDQNIKTIEKSLFEGLIDSKLISETHMGEL
KKAGWGRGARTDKGVHALCNGVNVKLAISEEYLMRGSPLRMDDKNPEEIQKEIQEKNEIL
LESEQYKKPEENSGEQQNANGNQASEKEIKSQAIEEEAADNDQEIAEEQEEQKEGEKNLE
ESKKVEDMTEEERQERSRRLQQEAEENRKKKEVSKAHHKQLQEFANERRKHIDIDKIINA
LNSNLPADIRCVSIKQVSRKFDIRTHCKYRVYEYLMPLFMYQKYDDIIAGTPMTEEFEQK
TMQRVSTLADKFKGTHNYHNYTRQMKAKDPRCMRYILDMKTELITNPQNGMKFIRFTLVG
QSFVYHQIRKMMGMICMMIQEDYPDNFMDSSFFHNVMRIWLAPAHGLFLNRMRFDSYNKK
PEIPEPIEFDKIEEDRLREMRDIIEKAVMNEEDVNAIYKQWIKDVKAGNELAEENESVSG
DMDQ


>TTHERM_00011450(gene)
ATGATTTAAACTAAAAGAAATTTCTTTAAGATCAAAGTAGCAATATTCTTTGGCTATAAT
GGCAAAGGGTACCATGGTTCATAGAGCTAAAAGGACTAAAACATTAAGACTATAGAAAAG
TCATTGTTTGAAGGTTTGATAGACTCTAAATTGATTAGTGAAACACATATGGGAGAGTTA
AAAAAAGCAGGTTGGGGAAGAGGAGCTAGAACTGATAAGGGAGTTCATGCATTATGTAAT
GGCGTTAACGTTAAGTTGGCTATTAGTGAAGAGTACCTTATGAGAGGTAGTCCTCTTAGA
ATGGATGATAAAAATCCTGAAGAAATTTAAAAGGAAATATAAGAAAAAAACGAAATATTA
TTAGAATCTGAACAATATAAAAAACCAGAAGAAAACTCTGGTGAATAATAAAATGCAAAT
GGTAATTAAGCATCTGAAAAAGAAATAAAATCCTAGGCTATAGAAGAAGAAGCTGCTGAT
AATGATTAAGAAATAGCAGAAGAATAGGAAGAATAAAAGGAAGGAGAAAAAAATTTAGAA
GAAAGTAAGAAGGTTGAAGATATGACTGAAGAAGAGAGATAAGAAAGAAGTAGAAGATTA
CAATAAGAGGCTGAAGAAAACAGAAAAAAGAAGGAAGTTAGTAAGGCTCATCACAAATAA
CTGTAAGAATTTGCTAACGAAAGAAGAAAGCATATCGATATAGATAAGATTATAAATGCA
TTAAACAGCAATTTACCAGCAGATATTCGCTGTGTTTCAATTAAACAGGTATCTCGTAAA
TTTGATATTCGTACTCACTGCAAATACAGAGTATACGAATACTTAATGCCTCTTTTTATG
TATCAGAAGTATGATGACATTATAGCAGGTACTCCTATGACAGAAGAATTTGAGTAAAAA
ACCATGTAAAGAGTTTCTACATTAGCTGATAAGTTCAAAGGAACTCATAATTACCACAAT
TACACAAGATAAATGAAAGCAAAAGACCCTCGTTGTATGCGTTATATTTTAGACATGAAA
ACTGAATTAATCACCAACCCTTAAAACGGAATGAAATTCATTAGATTTACTTTAGTAGGA
TAGAGTTTTGTTTATCATTAAATTCGTAAGATGATGGGTATGATTTGCATGATGATTTAG
GAAGACTACCCTGACAACTTTATGGATTCTAGCTTTTTCCATAATGTCATGCGTATTTGG
CTTGCTCCTGCCCATGGTTTATTCCTAAATCGTATGAGATTTGATAGTTACAACAAGAAA
CCTGAAATCCCAGAACCTATTGAATTCGATAAGATTGAAGAAGATCGTTTAAGAGAAATG
AGAGATATTATTGAAAAAGCAGTCATGAACGAAGAGGATGTTAATGCAATTTACAAATAA
TGGATTAAAGATGTCAAAGCAGGAAACGAGCTTGCTGAAGAAAATGAATCTGTTTCAGGA
GATATGGATCAATGA