Identifiers and Description

Gene Model Identifier

TTHERM_00316530

Standard Name

PUP3 (20S proteasome core beta subunit 3)

Aliases

PreTt20964 | 31.m00266 | 3687.m00068

Description

20S proteasome core beta subunit 3

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00316530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08424.13.999836123447869e-144proteasome A-type and B-type f
amily protein (210 aa)
OxytrichaContig22736.0.g933.0013199058937152e-77Proteasome subunit
SGDYER094C3.000745802558524e-63PUP3 Beta 3 subunit of the 20S
proteasome involved in ubiqui
tin-dependent catabolism; huma
n homolog is subunit C10
WormBaseWBGene000039493.000969471571755e-58locus:pbs-3 Proteasome subun
it beta type-3 status:Confir
med UniProt:Q23237 protein
_id:CCD73694.1
DictyBaseDDB_G02697721.9997255150861791e-53psmB3 on chromosome: 1 positio
n 3525818 to 3526839
Stentor CoeruleusSteCoe_194001.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316530(coding)
ATGGGTGATCCTTTTTCATATAATGGTGGTTCAATGCTTGCCATGAAGGGTGAATAATGT
GTAGCAATAGGTGCTGATCGTCGTTTGGGTGCATAATTCCAAACTGTAGCCACCAATTTC
CAAAAGGTTTTCAGAATCTAAGATAATATTCTTTTAGGTTTGACTGGTCTTGCAACTGAT
GTTTAAACATTCCACCGTTTAATTTAATATAAAGTAAACTTATACAGACTTAGAGAAAAT
AAAGACATGAAAGTTAATACTTTTGTAAATCTTATTTCTGCTACTCTCTACGAAAAAAGA
TGGGGTCCTTATTTTGTTTCACCTATTGTTGCTGGTTTAGAATATGATGAAGTAAAAGGT
GTTATTCCAATCACTGCTACTTATGACTCTATCGGTTGTACCTCTATTGAAGGAGAATTC
TAAGTTGGAGGAACTGGTGCTGATGGTTTAATAGGTTCTTGTGAATCCTTCTGGAGAAAA
GGTCTCAAGCCCGATGAGTTAGAAGACATCGTTGCATAAAGTTTAAGTGCTGGTTGTGAT
AGAGATATTCTTTCAGGTTGGGGTGGAGTAGTCTACACATTAACCAAAGACAATTTATCA
GTAAAAGTACTTAAGACCAAGCAATCTTGA


>TTHERM_00316530(protein)
MGDPFSYNGGSMLAMKGEQCVAIGADRRLGAQFQTVATNFQKVFRIQDNILLGLTGLATD
VQTFHRLIQYKVNLYRLRENKDMKVNTFVNLISATLYEKRWGPYFVSPIVAGLEYDEVKG
VIPITATYDSIGCTSIEGEFQVGGTGADGLIGSCESFWRKGLKPDELEDIVAQSLSAGCD
RDILSGWGGVVYTLTKDNLSVKVLKTKQS


>TTHERM_00316530(gene)
ATGGGTGATCCTTTTTCATATAATGGTGGTTCAATGCTTGCCATGAAGGGTGAATAATGT
GTAGCAATAGGTGCTGATCGTCGTTTGGGTGCATAATTCCAAACTGTAGCCACCAATTTC
CAAAAGGTTTTCAGAATCTAAGATAATATTCTTTTAGGTTTGACTGGTCTTGCAACTGAT
GTTTAAACATTGTAAATTAAAAATAAATGATTATTGAATTAGAATTTAAAAGAAAAATGT
TTAATTCACGAAATGTCATAAATAAAAAACACAATTTCATCAATAGATGAGATAGTAGAC
ATTAAATGAACACTTTTCATGAGCTTTCAATAACTAACAGAAGCCATATATTTACTTTTT
TAATTTAAAATATAGCCACCGTTTAATTTAATATAAAGTAAACTTATACAGACTTAGAGA
AAATAAAGACATGAAAGTTAATACTTTTGTAAATCTTATTTCTGCTACTCTCTACGAAAA
AAGGTAAACAAACCAAACCTATTTTCTACTTTAACTTAAGACGCAAATCATTAAATATCT
TTTGTTGATAAACTGTTTGGTGTAAAAACGTAAAGAATGTCAATCAAAATTAATTAATGA
GATTGTCATCTTTACTTGGAGAATACATCTTATTAATAAAGTTATTCAAATAAATGTTAT
TAAGGAAGGCTTTTTAAATTAGATTTAAAATCTTTGCACAATTTAATGAATCGTAAAGAC
AATAAAAACATTTATAAAGAGCTTTTTAATTTAAAAATAAAAGAGGAAAGATTTGCTAAA
GATTATTTATTTATTTATTTTTAGATAATAAAATCACAATAATTAGATGATTTACATTAA
TTTTATTAATTTGGTAATAAATCATTTTTAAACTAAAATAGATGGGGTCCTTATTTTGTT
TCACCTATTGTTGCTGGTTTAGAATATGATGAAGTAAAAGGTGTTATTCCAATCACTGCT
ACTTATGACTCTATCGGTTGTACCTCTATTGAAGGAGAATTCTAAGTTGGAGGAACTGGT
GCTGATGGTTTAATAGGTTCTTGTGAATCCTTCTGGAGAAAAGGTCTCAAGCCCGATGAG
TTAGAAGACATCGTTGCATAAAGTTTAAGTGCTGGTTGTGATAGAGATATTCTTTCAGGT
TGGGGTGGAGTAGTCTACACATTGTAAATATATTTAAAATAATTAGCAAATAAATAAATT
TTTTATTTAAAATTAGAACCAAAGACAATTTATCAGTAAAAGTACTTAAGACCAAGCAAT
CTTGA