Identifiers and Description

Gene Model Identifier

TTHERM_00043880

Standard Name

PUP2 (20S proteasome core alpha subunit 5)

Aliases

PreTt11065 | 3.m01862 | 3824.m02828

Description

20S proteasome core alpha subunit 5

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_00043880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01864.12.0009356157506544e-160proteasome A-type and B-type f
amily protein (250 aa)
OxytrichaContig622.0.g521.0002223712504345e-79Proteasome subunit
DictyBaseDDB_G02685383.000298514542485e-73psmA5 on chromosome: 1 positio
n 1022895 to 1023978
WormBaseWBGene000039265.000040196085687e-64locus:pas-5 Proteasome subun
it alpha type-5 status:Confi
rmed UniProt:Q95008 protei
n_id:CAB02097.1
SGDYGR253C9.9952060159684e-60PUP2 Alpha 5 subunit of the 20
S proteasome involved in ubiqu
itin-dependent catabolism; hum
an homolog is subunit zeta
Stentor CoeruleusSteCoe_109713.6251409191435593e-34

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00043880(coding)
ATGGCTGATAGCAACTATGATAGAAGTGTGAATACTTTCTCTAAGTTAGGTTAATTACTT
CAAGTTGAATATGCTATGCAAGCTGCTAAATAAGGTAGCACTTCAACTTCTATTGGTATT
AAAGTTAAAGGAGGAGTTATTTTGGCTGCTGAAAGAAAGTTCGATTCTTTATAAGAATCT
AGACTTATGATCCTTAACCACAATATAAAAATCTAAGAAATCGATACTCATATTTGTTGT
GTTCCTGCTGGTATTATTCCTGATGCTCGTACTTTGATTGATTACGCTAGAGTTGAATCT
TAAAACCACAGATTCACTTACAACGAACCCATGAGTGTCCGCTCTTTAACTCAAACTGTA
TCTGACTTGGCTCTTAACTTTGGTGAAGGTGATCCTTCTCTTAAGAGAAAGCCCATGCCC
AGACCTTTTGGTGTAGCCTTGTTAATTGCAGGTGTTGATGAAACCGGTCCCAGACTTTTT
AAGACTGATCCTTCAGGTTCTATGATGGAATATTAAGCTACTTGTATAGGTTGTGGTCAA
GAAGGTATTTAGCCCACTCTCGTTGAAAAATATGATGAAAATATGAGCATAAGAGAAGCT
GAAGTTTTAGCTCTTTCATGTTTAAAAGAAACTATGGAATAAACAGCAAGCAGAGATAAT
CTTGAATTAGCAGTTATTCCTATTGAAGGAGGTTAATTTATTGAAAGAACTCCTGATTAT
ATTGATGAAATCCTTTAAACTTTGGGCTGA


>TTHERM_00043880(protein)
MADSNYDRSVNTFSKLGQLLQVEYAMQAAKQGSTSTSIGIKVKGGVILAAERKFDSLQES
RLMILNHNIKIQEIDTHICCVPAGIIPDARTLIDYARVESQNHRFTYNEPMSVRSLTQTV
SDLALNFGEGDPSLKRKPMPRPFGVALLIAGVDETGPRLFKTDPSGSMMEYQATCIGCGQ
EGIQPTLVEKYDENMSIREAEVLALSCLKETMEQTASRDNLELAVIPIEGGQFIERTPDY
IDEILQTLG


>TTHERM_00043880(gene)
ATGGCTGAGTAAACAAATATTTTCAATTAAGATTCAAAATGAAGATAATTTAAATTGAAA
CGATGCCTACTAATGATATAGGCTATATTTAATTCATAAAATAGAGATTCGAGTTAGTTT
AAATTGTTTTTTTATAAATTAATTACAGTAGCAACTATGATAGAAGTGTGAATACTTTCT
CTAAGTTAGGTTAATTACTTCAAGTTGAATATGCTATGCAAGCTGCTAAAGTAATAAATA
TTACAAGCTTAAAAATACACTTTTTATTTAATAAGTTGCTTAGCATTTTTATTTTTTGAA
ATTGAGTCGCTGAGCAATTTCTACTTCTTTTGAATTTTTTAAACACAAAATCATAAAAAT
AACAATAACTATTTAATTATAAAGTAAGGTAGCACTTCAACTTCTATTGGTATTAAAGTT
AAAGGAGGAGTTATTTTGGCTGCTGAAAGAAAGTTCGATTCTTTATAAGAATCTAGACTT
ATGATCCTTAACCACAATATAAAAATCTAAGAAGTAACTCAAGAACATTTATTTACAAAA
TTCTTTAAAATAATTTAAATGATCTAAATGATAGTCAGTCACAATAAAATTATATGGACA
TTAGCAAGATATAAAAAAATACTAATAAATATATTAAAGCAAATTATTATAAAAGTTTCT
AATTTAACTTTTAAATATTTAAATTAGATCGATACTCATATTTGTTGTGTTCCTGCTGGT
ATTATTCCTGATGCTCGTACTTTGATTGATTACGCTAGAGTTGAATCTTAAAACCACAGA
TTCACTTACAACGAACCCATGAGTGTCCGCTCTTTAACTCAAACTGTATCTGACTTGGCT
CTTAACTTTGGTGAAGGTGATCCTTCTCTTAAGAGAAAGCCCATGGTAATTATTTATTAA
TTTGTTGTTTATTTAAACTAAAACTTATTGTTAAATTAGATCAGAAAACAATCAAAATTT
ATAAAAAAAATTTATCTAAATAAAATAAAAGATCAAAATTTATTGTTTTATCAAAATCTA
TTTTTTAATAAAATATTTTTTAATTTATTTAATAGCCCAGACCTTTTGGTGTAGCCTTGT
TAATTGCAGGTGTTGATGAAACCGGTCCCAGACTTTTTAAGACTGGTAAGTTAAATTTAT
TTATCAAACTTTTAATTTAAAGTATTTTATAAATTATGCAGATCCTTCAGGTTCTATGAT
GGAATATTAAGCTACTTGTATAGGTTGTGGTCAAGAAGGTATTTAGCCCACTCTCGTTGA
AAAATATGATGAAGTAAATATTGAAATAAATTTTATAAATATATATAAAAATATAATAAT
TAATATAGAATATGAGCATAAGAGAAGCTGAAGTTTTAGCTCTTTCATGTTTAAAAGAAA
CTATGGAATAAACAGCAAGCAGAGATAATCTTGAATTAGCAGTTATTCCTATTGAAGGAG
GTTAATTTATTGAAAGAACTCCTGATTATATTGATGAAATCCTTTAAACTTTGGGCTGA