Identifiers and Description

Gene Model Identifier

TTHERM_00633530

Standard Name

PUP1 (20S proteasome core beta subunit 2)

Aliases

PreTt28022 | 90.m00186

Description

20S proteasome core beta subunit 2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00633530

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15827.14.0006013729588566e-158proteasome A-type and B-type f
amily protein (323 aa)
OxytrichaContig17526.0.g722.9993408039826107e-81Proteasome subunit
DictyBaseDDB_G02836794.000010081770683e-74psmB7 on chromosome: 4 positio
n 967091 to 968259
SGDYOR157C7.999439018944131e-69PUP1 Beta 2 subunit of the 20S
proteasome; endopeptidase wit
h trypsin-like activity that c
leaves after basic residues; s
ynthesized as a proprotein bef
ore being proteolytically proc
essed for assembly into 20S pa
rticle; human homolog is subun
it Z
WormBaseWBGene000039481.9992362000979228e-56locus:pbs-2 Proteasome subun
it beta type status:Confirme
d UniProt:O62102 protein_i
d:CAB16855.1
Stentor CoeruleusSteCoe_286888.194012623990515e-40

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00633530(coding)
ATGAGTTACTTGAATGCCATTAAAGAAAACTAGGGAGGATTCAATTTCGATTTATGTTTG
AGAAATAATGAATTAGTTTCCAAGCAAATCGTTTCCAGCCCTCATTTCACTAAGACTGGT
ACTACAATTGTAGGTTTAGTTTATAAGGATGGTGTTGTTTTGGGTGCTGATACCAGAGCT
ACTGCTGGCACTATTGTAGCTGAAAAAAGTTGCAGCAAAATTCATTATATTGCTCCTAAT
ATGTATTGCTGTGGTGCAGGAACTGCTGCTGATACCTAATGGGTTACTGATAGACTCTCT
TCTGAATTAGAATTAATGAGACTCAACACCAATAGATAATCTAGAATTGCTGGTGCTATT
GCTCGTCTTAGAGAACATTTATATCAATATTAAGGTCACGTCGGTGCTCACTTGATTTTA
GGTGGTTTTGATTGCCAAGGTCCTCAATTAGTATCCGTTGCTGCTCATGGTTCTTTCTCT
TATCTTCCTTATGCTACCATGGGTTCAGGATGTTTGGCTGCTATTGCCACTTTAGAATCT
AGATATAGAGACGATTTAACTGAATAAGAAGCTATCGATTTAGTTACTGCTTCAATTGAA
TCTGGTATTGTTCACGATTTAGGTTCTGGTTCCAACGTTGATGTATGTGTTATTAAAAGA
GATCCTAAGGTAGATGTTAAAGTAGATTACTTAAGACTTCATAAGACGTATATTTATTTA
TTTTATATTTTCAAGCAAGTTTAAATAAATAAATGTATATAAAAAAAGCGATAACAACCA
AAGACTTAACAAGCCATTCCCTTACAAAGCTATTCCTAACAACCACCCCTTCCATAGATA
ATTCAATGTTCCCATCGAAAAAATTCCCGTTAATGTCGATCCTTCTAAAAACGAAATGGA
AGTAGAATGAGAAAAATAATAATGCGAGCAAATTCGTTTTTGGCATTACTTTTTTATAAA
ATATACTTAAAAAATAAAATAAAATATAATTAAATGTAATTTAAAACATATATTTTTAAC
GACTTCATACACGTATTTTTACCAAAATTTAAAAATTTATTGAAGATAAATTAAAATATT
TGCATATCTATTTTTATAATTTTTTTAAATAAATAATTCGTTAATAATTTACAATAAAAT
CATTCGTTAATAAAGTACAATAAAATCGAACATGAAATATTTTTATTGGATTTATGA


>TTHERM_00633530(protein)
MSYLNAIKENQGGFNFDLCLRNNELVSKQIVSSPHFTKTGTTIVGLVYKDGVVLGADTRA
TAGTIVAEKSCSKIHYIAPNMYCCGAGTAADTQWVTDRLSSELELMRLNTNRQSRIAGAI
ARLREHLYQYQGHVGAHLILGGFDCQGPQLVSVAAHGSFSYLPYATMGSGCLAAIATLES
RYRDDLTEQEAIDLVTASIESGIVHDLGSGSNVDVCVIKRDPKVDVKVDYLRLHKTYIYL
FYIFKQVQINKCIQKKRQQPKTQQAIPLQSYSQQPPLPQIIQCSHRKNSRQCRSFQKRNG
SRMRKIIMRANSFLALLFYKIYLKNKIKYNQMQFKTYIFNDFIHVFLPKFKNLLKINQNI
CISIFIIFLNKQFVNNLQQNHSLIKYNKIEHEIFLLDL


>TTHERM_00633530(gene)
ATGAGTTACTTGAATGCCATTAAAGAAAACTAGGGAGGATTCAATTTCGATTTATGTTTG
AGGTAATTTAGCAATTCTGTTTAATGTTTGCATCATTTAGTTAGTTATTCTTGATGATTC
ATAAAGCTAACTAACTTTGCACTTGATCAATTAACATTCATTTTTAAAACTAGAAATAAT
GAATTAGTTTCCAAGCAAATCGTTTCCAGCCCTCATTTCACTAAGACTGGTACTACAATT
GTAGGTTTAGTTTATAAGGTATATTGATTGATTGATCAGTTAATTTATTTATCAATTTGG
CACAACCATTCTTAAACATCTTTACTTTTACAAGCCTTAGCTGACTTCTTTTAATAATTA
TAACAATAAAGGATGGTGTTGTTTTGGGTGCTGATACCAGAGCTACTGCTGGCACTATTG
TAGCTGAAAAAAGTTGCAGCAAAATTCATTATATTGCTCCTAATATGTATTGCTGTGGTG
CAGGTAAAATTAAAAATTTCTTTAATATATTAAGGAGATTAAGATTTTTTAAACTTAAAA
ATAAATAGGAACTGCTGCTGGTAATAATTAATTAATTAATTCTTTGATCATTTGTTTAAA
AAGAAAGAAAAAAATGGATTATATCATAATTTAACATGAAGATATTTGCAAGAAATGACT
TGCTTTCAAAGCTATTTTAGATTTTTTCATTATACAATTCTGCAATTACAATAAGAATAA
AAGATCAAAGGCTTTTTTGTCAAAAAAAAATAATTAATGATTTTCTTTTTACAAAACAGA
TACCTAATGGGTTACTGATAGACTCTCTTCTGAATTAGAATTAATGAGACTCAACACCAA
TAGATAATCTAGAATTGCTGGTGCTATTGCTCGTCTTAGAGAACATTTATATCAGTAAAA
TAATCAAATTCACTATATACTATTATTAATTTATAGTTCTATATTGATTTTTATTTGAAT
TTATTTGAAGATATGCTTAAAATAATTAACAAATAGATATTAAGGTCACGTCGGTGCTCA
CTTGATTTTAGGTGGTTTTGATTGCCAAGGTCCTCAATTAGTATCCGTTGCTGCTCATGG
TTCTTTCTCTTATCTTCCTTATGCTACCATGGGTTCAGGATGTTTGGCTGCTATTGCCAC
TTTAGAATCTAGATATAGAGACGATTTAACTGTAATTTTTACAACTTATATATATATAAT
TATCAAACAAAAACATGTTTTTCAATCATTTTCGAAGAGGAAAATATTTAAATAATATAT
ATTTAAAAAAAATAGGAATAAGAAGCTATCGATTTAGTTACTGCTTCAATTGAATCTGGT
ATTGTTCACGATTTAGGGTAAATAAAATAATATAAAAGAAAGAATAGGTTTTAAAACATA
TACTAATTTAAAATAGTTCTGGTTCCAACGTTGATGTATGTGTTATTAAAAGAGATCCTA
AGGTAGATGTTAAAGTAGATTACTTAAGACTTCATAAGACGTATATTTATTTATTTTATA
TTTTCAAGCAAGTTTAAATAAATAAATGTATATAAAAAAAGCGATAACAACCAAAGACTT
AACAAGCCATTCCCTTACAAAGCTATTCCTAACAACCACCGTAACTATTTTTTACTTAAT
TACTTCATGAAGAGATCTAAACAATATTTAATTAAAAAATAGCCTTCCATAGATAATTCA
ATGTTCCCATCGAAAAAATTCCCGTTAATGTCGATCCTTCTAAAAACGAAATGGAAGTAG
AATGAGAAAAATAATAATGCGAGCAAATTCGTTTTTGGCATTACTTTTTTATAAAATATA
CTTAAAAAATAAAATAAAATATAATTAAATGTAATTTAAAACATATATTTTTAACGACTT
CATACACGTATTTTTACCAAAATTTAAAAATTTATTGAAGATAAATTAAAATATTTGCAT
ATCTATTTTTATAATTTTTTTAAATAAATAATTCGTTAATAATTTACAATAAAATCATTC
GTTAATAAAGTACAATAAAATCGAACATGAAATATTTTTATTGGATTTATGA