Identifiers and Description

Gene Model Identifier

TTHERM_00643580

Standard Name

PUF4 (Pumilio-family protein 4)

Aliases

PreTt10628 | 92.m00170

Description

Pumilio-family RNA binding repeat containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00806 ) Pumilio-family RNA binding repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00643580

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05178.12.9990539278805726e-74TPR Domain containing protein
(1270 aa)
OxytrichaContig22789.0.g90.00000000000059990805086298Pumilio-family RNA binding rep
eat
WormBaseWBGene000014020.0000000000006997872742366828locus:fbf-2 Fem-3 mRNA-bindi
ng factor 2 status:Confirmed
UniProt:Q09312 protein_id
:CCD66119.1
SGDYLL013C0.000000000010004361180063202PUF3 Protein of the mitochondr
ial outer surface, links the A
rp2/3 complex with the mitocho
re during anterograde mitochon
drial movement; also binds to
and promotes degradation of mR
NAs for select nuclear-encoded
mitochondrial proteins
DictyBaseDDB_G02899870.0000000400154582995175DDB_G0289987 on chromosome: 5
position 3515224 to 3518414

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00643580(coding)
ATGAGTAGAAAGATTTTGATATAGCTGTATTCTCAAAGAGACTCTCCTCACCTCTTCGTC
AATAGAAGCAAGTCTGCTGATTGCGATAGAGAGGAGAATTTAGTTCATTATACCTACATC
AATCCGCGGATAATTAAGTATATTTTGCAAGAAGAAACAGAGAGATAAGATAACAGTTAA
GAACATGAGAGAAGCATAGCAAATAATTAGTCAAAGCACGACTAATTCAATAGCGATGAA
TTAAACAGGGATAAGTCTATTTCTGATAATCTTTCTTCCTCTCCCATGTAGTAAAAACCA
CTTAAAGAGAAGAAACTGAAATTCAAAAACCTAAACTTTAATCCAAGTGTAAACACAAAC
GCTGATTCTAATTATAGTCTCGAAAATAATCAAGAAACACAAGTTTCTCAAAACATTTAG
TCTTCTTAGCAAAACTTATAGGTATATCAACAACACTTCAAGGATAGCAATTATTCATAT
CAATCCTAACACAGCAGTGAAAGTGTTGCTTCCAATTTGAATACAACCATAAAATCTACA
AGTTTAAACCTAGATGAACCATCTTACTGTGATTTCAAAAAGGAAGAAAATGACTCAAAA
AGACTATAGGAGGAGTACTAAAAAAACAAATTCTAAACATTCGAAAATGAAATAAAAAAT
AATTTAATTAAATTCTCTACTAATCGCTATTATAAATTTATTCTTTAGAATGTGCTTGAA
TCAGATTTAATATTTAGAGATTGTGAATAAGTAGAGTAAATTTATTTTAGCAGATTCGGT
TAAAAGATTATTAGGGAGTATTTAAATATACTCGAAGGTGAAGATTTAGTTCAACTGCTT
AAAGTAATCAACACAAAGTTATTAGATCCATTTGAATTTAGTGAACAAAAAATTGATTTT
CTGAGCAATAATTTGCTAAGCAAAAAATACCTTTGTGGCGAGCAATATGGATGTCTAATT
GTAAATTACATAGTAGAGCAGTATTCCTAGAATCAATTCAAAGAAAGCACTCAATTGATT
AAACAAGAAATTATTTTATAAAAGATTCACCAAATAATAATGAGGATAGTAAAAAAAGCT
CATCAATTGTCGTAGCATTATTACTCAAACTATGTGATACAGCTTATTTTGGAAAAATTA
CCCAATGATTGCGAAATAAATTAATAGTTGAATAGAGCACTTCTTCCTTACTTCATTGAT
TTAAGCACTAACAAATTTGGAAGCAATGTGGTTGAAAAGGCTATTAGATTTGGTGATGAT
TATTTTAGAGAAGAGATTTGGAAGATTATCAGTTACTAAAGTGAAGATGGCTAATTTATT
AACTTAGAGATACTAGTTAATGATCAATTTGCAAATTATGTGATTTAAAGATATTACGAG
CACTGTAATTCATATACTATAAAATAATAATTTGAGGAAATACTTCACATACTTAACAAT
TAAAGTAGGCTTCAGCAATACGGCTAACATGTAAGAATGTAAATATTTGATAAAAACAAA
CCAGAATCAAAAGTCCATCACCTTTAGCAGAAAGATTATAATAGTTCTAACATTAATAGA
AGTTACTATTCATAAAATACTAAGATTGGTAATACCAGTAGCTTAAATAATAATTTCAGT
AACACAATTTCTCAAAAAAGATACAATTATTCCAGAAATGGAAGCATAGTAAGTAATGAG
AGTGGTGGCTTAGAGTCAGTGAGCAGTAGAAAAAGCAGCTCTAATATTCCTACTCATCTG
ATAGATCAGTCCAATCAAAGCAATTTGGTATAAACTATACCATCTTAGCAGTCTGCTTAA
TAATTTATGCCACCTAATGATTAAAATATAATAGGGTATGGGAATAATAACTATTAAAAA
AATTACAGCTTAGGTGTCAATCCTCCTAAAAACCAATTTAATAATCAATATTTTAACTAA
AATGGAGGTATCCATCCATTTAGCTATAGCTAAAATGTAAATTAAAAAGCTTAGCACTTT
AGCAATACTTTTCAGCAAACTCAATTCTAATAAAGTAATGCTTGCACTTCATATCCTTTA
GAAAATCCGTACTAAAAAACTCAAAATCAGAATTAACTCTTCAATTAAAGTCACCCAAAT
TATTTCAATAGCCAAAAGAATCAGTTTAAACCAAAGTTAACTATGTAAGGAGGCAGTTAC
AAAGGAGTCGGACAGAAGATCATTACAAATAATTTCTAATAAATGAACGAAGGGTATCAA
GTAAATTATAGTAATTATCAGAATATCTAAAATATTAATAATGTCTAAGGCAGAGATTAG
AAATTATCAGCTGAAAATAATAGAAAAATGCTAAATTAAAATTATGGCAATACAAACTAA
TTAGATTTAAAATTATCTATCGACGACTAAATAAACAAATCTGAAGGCTAGCAGAAATAT
TTTTAAGAGAACCTTAATTAAGATCAAGAGAGTTATCAGTGA


>TTHERM_00643580(protein)
MSRKILIQLYSQRDSPHLFVNRSKSADCDREENLVHYTYINPRIIKYILQEETERQDNSQ
EHERSIANNQSKHDQFNSDELNRDKSISDNLSSSPMQQKPLKEKKLKFKNLNFNPSVNTN
ADSNYSLENNQETQVSQNIQSSQQNLQVYQQHFKDSNYSYQSQHSSESVASNLNTTIKST
SLNLDEPSYCDFKKEENDSKRLQEEYQKNKFQTFENEIKNNLIKFSTNRYYKFILQNVLE
SDLIFRDCEQVEQIYFSRFGQKIIREYLNILEGEDLVQLLKVINTKLLDPFEFSEQKIDF
LSNNLLSKKYLCGEQYGCLIVNYIVEQYSQNQFKESTQLIKQEIILQKIHQIIMRIVKKA
HQLSQHYYSNYVIQLILEKLPNDCEINQQLNRALLPYFIDLSTNKFGSNVVEKAIRFGDD
YFREEIWKIISYQSEDGQFINLEILVNDQFANYVIQRYYEHCNSYTIKQQFEEILHILNN
QSRLQQYGQHVRMQIFDKNKPESKVHHLQQKDYNSSNINRSYYSQNTKIGNTSSLNNNFS
NTISQKRYNYSRNGSIVSNESGGLESVSSRKSSSNIPTHLIDQSNQSNLVQTIPSQQSAQ
QFMPPNDQNIIGYGNNNYQKNYSLGVNPPKNQFNNQYFNQNGGIHPFSYSQNVNQKAQHF
SNTFQQTQFQQSNACTSYPLENPYQKTQNQNQLFNQSHPNYFNSQKNQFKPKLTMQGGSY
KGVGQKIITNNFQQMNEGYQVNYSNYQNIQNINNVQGRDQKLSAENNRKMLNQNYGNTNQ
LDLKLSIDDQINKSEGQQKYFQENLNQDQESYQ


>TTHERM_00643580(gene)
ATGAGTAGAAAGATTTTGATATAGCTGTATTCTCAAAGAGACTCTCCTCACCTCTTCGTC
AATAGAAGCAAGTCTGCTGATTGCGATAGAGAGGAGAATTTAGTTCATTATACCTACATC
AATCCGCGGATAATTAAGTATATTTTGCAAGAAGAAACAGAGAGTAATTAAGTTTGATTT
CAATTTCTTTCTACCATTTTTTGCTTTGTCACCACTATCAAATATCATTCAATTTAATCA
ACTGAAAGCAAAAATTTAGCAACAAGAAAGAATATAAGCTAAGCATAAAATTTATTAAAA
CATATTTAATTATGATTAGGATAAGATAACAGTTAAGAACATGAGAGGTAAAGATCATTT
TCTGAGTTTAAGCAAGTGTGAAAAAAGATACATTTGTGTCGGTCTCCAACAAAAATTAAA
CAAAAGATTTTTATTATTATCAAAAGCGAATAAATAAATAAAGCAAACAAACAAACAAGC
AGAATGAAATAATTAGAGTTGATAAAAACATAATTTAATTAAAAAAAATCTGCATTATTA
ATTTTTTTTCTTTAATTGTTCCAAAATCTTTTATTAGGAATCATCAAAACAATCAACAAT
AAACAAATAAATAAATTAATAACAAAGACAATTCACCAAAAAGTCTAAATTATTTTCTCT
CTTTTCATAGCATTGAATAGCAGCTCATTTTTTGATATTATTAAAAAGAAGCATAGCAAA
TAATTAGTCAAAGCACGACTAATTCAATAGCGATGAATTAAACAGGGATAAGTCTATTTC
TGATAATCTTTCTTCCTCTCCCATGTAGTAAAGTAAAAGATATTTATTTATAAGAATTTC
AAGCAATTTTAGTATTTTCAGCTAACTAAACCCCTTTCTTCTTACTTAATTTGAAAAATT
TATAAATAAGATTTTAGAAATTTAGTAGCTTTTTGTAAAAACAACATTTTTACATTCATA
TTTCAAAGAAAAATATTAAAAAGCATCATTTTTAAGAAAAAGCTCTTGCTTTGAATGTGT
AATGAGATTATTAATTGATTAAAAAATCAATTAGAGAAGTAAAATTTAACCTAAATTGCT
TAATTAAAAATTATTAATTCAAAAAAAGTCAAATTTCCTCTTTAAAATGCAAAATATTAT
TTTATTTTATTTTATCAGCTTACTTTATTTATGTAAAAAATAAGAACCACTTAAAGAGAA
GAAACTGAAATTCAAAAACCTAAACTTTAATCCAAGTGTAAACACAAACGCTGATTCTAA
TTATAGTCTCGAAAATAATCAAGAAACACAAGTTTCTCAAAACATTTAGTCTTCTTAGCA
AAACTTATAGGTATATCAACAACACTTCAAGGATAGCAATTATTCATATCAATCCTAACA
CAGCAGTGAAAGTGTTGCTTCCAATTTGAATACAACCATAAAATCTACAAGTTTAAACCT
AGATGAACCATCTTACTGTGATTTCAAAAAGGAAGAAAATGACTCAAAAAGACTATAGGA
GGAGTACTAAAAAAACAAATTCTAAACATTCGAAAATGAAATAAAAAATAATTTAATTAA
ATTCTCTACTAATCGCTATTATAAATTTATTCTTTAGAATGTGCTTGAATCAGGTAAAAT
GAGTTTATTTATTTTTGTATAAATTTCAAAGCAATTAAAGAGTGTTTTTAGAATTTTAAT
TCAAAATAGAATTTTATAAAAATCAGTATTTAATTTGTTTTACATTTTTTAAATAAAACA
CTTTTTTTAAAAATAGTTTAAAAATAAAATTAATTATTAAAATTTATTTGTTAAGGATTT
TTATTAATTTTTTATTGATTTAATAGAAATAATTTTTTAATATATTTAAGGAAATTATGG
CCACAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGAGTTATGTAG
ATTTAATATTTAGAGATTGTGAATAAGTAGAGTAAATTTATTTTAGCAGATTCGGTTAAA
AGATTATTAGGGAGTATTTAAATATACTCGAAGGTGAAGATTTAGTTCAACTGCTTAAAG
TAATCAACACAAAGGTAAAATATTTTAATATAGCTTTTTAAAATTTATGTATGGCGTATG
AATAATTAAATAAATAAATATTAGTTATTAGATCCATTTGAATTTAGTGAACAAAAAATT
GATTTTCTGAGCAATAATTTGCTAAGCAAAAAATACCTTTGTGGCGAGCAATATGGATGT
CTAATTGTAAATTACATAGTAGAGCAGTATTCCTAGAATCAATTCAAAGAAAGCACTCAA
TTGGTATTTCTTTTTATCATTTTAAATAATTTTACTTTCAAAAAGTATATTCTTGTTTAT
TTTTTAAGCTGCAACCTTTCAATTTAAATCAAACAATAATTAGAATTTGCAAATTAGTTC
TAATTATTAATTGCAAAATATCTAAAATGGTTTGTTTTTTAGTAAGTATTTGTGCATAAA
AATATTTACGAAACTGTTTTATTTTTTAAATTTAGATTAAACAAGAAATTATTTTATAAA
AGATTCACCAAATAATAATGAGGATAGTAAAAAAAGCTCATCAATTGTCGTAGCATTATT
ACTCAAACTATGTGATACAGCTTATTTTGGAAAAATTACCCAATGATTGCGAAATAAATT
AATAGTTGAATAGAGCACTTCTTCCTTACTTCATTGATTTAAGCACTAACAAATTTGGAA
GGTAAAGAATACATTATTAATTAAATATTTAATTATAAAGAGGATTTAAATGGTATATAT
TTTAAAAATAAATAATAGCAATGTGGTTGAAAAGGCTATTAGATTTGGTGATGATTATTT
TAGAGAAGAGATTTGGAAGATTATCAGTTACTAAAGTGAAGATGGCTAATTTATGTAATT
CATACTTTATTTAAAAATATTTTTGTTTGTTTGAAGTAATTAAATTATAAAAATAGTAAC
TTAGAGATACTAGTTAATGATCAATTTGCAAATTATGTGATTTAAAGATATTACGAGCAC
TGTAATTCATATACTATAAAATAATAATTTGAGGAAATACTTCACATACTTAACAATTAA
AGTAGGCTTCAGCAATACGGTAATAATTAAAAAAGAAATTTTATTACAATTTTAAATTGT
ATTTAAATTAAAATTGACTGTAATAAACATTTAAATATACAGGTGCATCATAAAATAATA
TTTATTTTATTAAATTATTTAAAAATACATTAAGTCGAATTGCTCAACCTTAAAATTATT
CACTAGTTTTGCACTTATTTTATTATTGCATCGCTTTTATAGTTCTAATTCCCTTCTTTA
CATTATACTTTCTTTAGCAAACTTTAGAGTGGGGAATTTACACATTTTAATATTTCTTAG
CAGCAGCAGATCAGTCTTTGTTGAAATTTTATAAATTTGTTAAATTCTATTGAAAGCAAT
TACTAAAAATACAAAAAATACAAAAATTTTGCTTACCCTATCTTTTATTTAATAACAAAT
AAATATTATTTATTTTTATGTTTAATTTTTTTTTTTTTGAGGAGTTTACACTTTAAAAAA
ATTTATTTATATATTTATTTATTATAAGAAGCAATTTACTTTAGATTTGTAAACTTATTT
TATGATTAATTTGTAAATTTTTTTAATAGGCTAACATGTAAGAATGTAAATATTTGATAA
AAACAAACCAGAATCAAAAGTCCATCACCTTTAGCAGAAAGATTATAATAGTTCTAACAT
TAATAGAAGTTACTATTCATAAAATACTAAGATTGGTAATACCAGTAGCTTAAATAATAA
TTTCAGTAACACAATTTCTCAAAAAAGATACAATTATTCCAGAAATGGAAGCATAGTAAG
TAATGAGAGTGGTGGCTTAGAGTCAGTGAGCAGTAGAAAAAGCAGCTCTAATATTCCTAC
TCATCTGATAGATCAGTCCAATCAAAGCAATTTGGTATAAACTATACCATCTTAGCAGTC
TGCTTAATAATTTATGCCACCTAATGATTAAAATATAATAGGGTATGGGAATAATAACTA
TTAAAAAAATTACAGCTTAGGTGTCAATCCTCCTAAAAACCAATTTAATAATCAATATTT
TAACTAAAATGGAGGTATCCATCCATTTAGCTATAGCTAAAATGTAAATTAAAAAGCTTA
GCACTTTAGCAATACTTTTCAGCAAACTCAATTCTAATAAAGTAATGCTTGCACTTCATA
TCCTTTAGAAAATCCGTACTAAAAAACTCAAAATCAGAATTAACTCTTCAATTAAAGTCA
CCCAAATTATTTCAATAGCCAAAAGAATCAGTTTAAACCAAAGTTAACTATGTAAGGAGG
CAGTTACAAAGGAGTCGGACAGAAGATCATTACAAATAATTTCTAATAAATGAACGAAGG
GTATCAAGTAAATTATAGTAATTATCAGAATATCTAAAATATTAATAATGTCTAAGGCAG
AGATTAGAAATTATCAGCTGAAAATAATAGAAAAATGCTAAATTAAAATTATGGCAATAC
AAACTAATTAGATTTAAAATTATCTATCGACGACTAAATAAACAAATCTGAAGGCTAGCA
GAAATATTTTTAAGAGAACCTTAATTAAGATCAAGAGAGTTATCAGTGA