Identifiers and Description

Gene Model Identifier

TTHERM_00221110

Standard Name

PUF3 (Pumilio-family protein 3)

Aliases

PreTt22439 | 18.m00465 | 3701.m00222

Description

Pumilio-family RNA binding repeat containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05672 ) E-MAP-115 family
  • ( PF02758 ) PAAD/DAPIN/Pyrin domain
  • ( PF00806 ) Pumilio-family RNA binding repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00221110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06792.19.997093137033517e-262pumilio-family RNA binding rep
eat containing protein (871 aa
)
WormBaseWBGene000042442.99851380290819e-19locus:puf-8 status:Confirmed
UniProt:Q09487 protein_id
:CCD66262.1
OxytrichaContig22789.0.g97.001446474249442e-19Pumilio-family RNA binding rep
eat
SGDYLL013C5.000468829272308e-18PUF3 Protein of the mitochondr
ial outer surface, links the A
rp2/3 complex with the mitocho
re during anterograde mitochon
drial movement; also binds to
and promotes degradation of mR
NAs for select nuclear-encoded
mitochondrial proteins

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88

Sequences

>TTHERM_00221110(coding)
ATGGAAACCGCAATAATGTAGCAAGAGTAATTGTATCCTAGAGTACATAACATTCAGCAA
ACTGCCAGTAATCATTCTGAAGAAGAAGATTTAAGCACAATCCCTTGCTTAATATCAGTG
AAAAAGTCGCATTCGACTCCTCAGAATAGCTTGGCTGATAAAATTAATCAATTTTCTGAT
CGCCAATAGCAGTAGAAAGAAAAAGAATTGCAAGAGATAAAAGAATAGGAGAAAGTAGAA
ACATCAAATGAAGAGCAAGTGATCAATAGAAACAAGCAAAACTCAGCTCAATAATAAAAG
AAGAAATAAGAAAAAGATGTAGAAATGAGAAAAATTTCTACTGCAGCCTCTGAAGAATTA
AAAACTGATTACCCTCAGCAACTTAGCAAAAGCAATTCAAGTTCTTAATGCAACTTGTTG
GATTACAAAAATACTTTAATTGACTCAAATGACTAAAAGAGTGATATTATGGCCAAACAA
GAAAATCAAACTAATATACAAAGACAGGAGGAATCTAAAAAGTTATAGACGCTATATCAA
GAATCAAGTGAGAAAAATAAGCTATTTGAAGAAAAAATTAGAAAAAGCATAAAAGAATTT
GCTTTGGATAAATACTCCCACTTTGTTTTAATTCTTGTTTTAGATATAGGCTCTTCCGGT
CATAAGAGAATAATAATTGAAAGTACATTAAAAGAGAAAGAACTATTCAGCCATGAACAA
TTTGGTCACAAGATTTTAAACAAATGCATTGAAGTCTCTAAAAAAGAATTCATTGATTAA
TATAATGAATTCATCAAATATATTTTAGACAACTAATCAAAGACTTATCAGACTCTTCAA
AATGATAAATTTGGTAATTATGTTATTTAAAAATGCTTAGAAATTTTTGATGAAGACCAT
TTATCACAGCTTCTGATTCTTCTGAATGCAACACTTCTAATCAAACCTGAGCAAAAGCTT
CCTAATTTACCAAAAGAAAGTTAATTAAAAGATAGTGATCTTTGCTCTGATTAATATGGT
TGCTTAATAATATAAAAATTAATTGAAATATATAAGACCAAGCCTGATTCAAAAATCAAA
AAACAAGTGGGACAAATGATTGAAAAAGTGATTAATGATTCACACCGCTTAGCATAAAGA
TAATTTTCCAATTATGTTGTACAGCAAATAATTGAAAAAGGTGCTCCTGAACACAAGAAT
ATGTTATATCAAAATGTGATTTCAAAACACTTCATAAGCTTAGCTATGGATAAATACGGA
AGTAATGTAGCTGAAAAAGCGATAAAATATGCTGAGCCAGATTAAAAAAAATAAATTTGG
GGTCTGATTTCTGCTAACAATTTTAGTGCTTTACTTAACATGGTAAATGACCAGTATGCG
AATTATGTAGTCTAAAGAATTTTTGATTCATGTTCTAACAAAGAATAAAAATAAATACAT
TAATAGCTAAATTTATGGAGCAAAAAAAATCTTTTAAAAGAAAATGGTAAGCATCCCTTC
AAATATATTGATGACCTTCTAAGACAAAATGAGTTTCATAATAATTCTAACAACAGCTTT
AGAAGTAATCAAGGCAAGATGGTAGCTTAGGGCAATTTCTCTACTAATAATAACTAGCAT
AGCTATTAAAATAGAAATAATTAAAATATGATGCATAATAATTAGAAATAATCTTAACAC
TTTAATAATTAAAATATGAATATGGAATACAACTAAACAATGAAGCAAACCAACTATGGT
TTAGTAAATAAAAATAATTTTAATTAAAAAAATCAAAATTAACATCAAAATGTTAATTAA
CCGAATTTCAACTAAAAGCACAGATAAAATAACATCAACAACAGTAGTAACAACTAGATG
ACCTCTTAAATGAAAAATCCTCAAATTTAAAACAACTAAAATTAAGAGTCACCTTCATCT
AACAAGCAAGTTTAGAAGTATGATTAAAATAATTTCAATAAAACTAGCAATAGAAAATAA
TCAATTCATAACAACTAACAACAATTTTAAAATGTAAATAATAACAATTTCAGCTATAAC
AAAAACTAAAATGTTGAACCTAACTAAAGCTAAGGATAATAAAATAATAATTATGATGTG
TAGATTAAAAATGGAAATACAAATAACAATAACTATAGCAGCTATAATAATCAATACTCT
TCCCATGGAAAAAGAAATCAATAAGGAAATTATAACTCTTAATAAACTAACAGCAACAGA
CCTTATAGGAGATAAAACAACCATAGAGGAAATTATAATTATCACAATCCAATTTATTAC
CAAAGCTATCCTTAACAATACTTTATGTAATAACCATATTTTGGATTTACTCCCTACATT
TATGTCAATTAGCCTTCTGAATTTACTGACCCATAACTTTTAAACTATTTCGATCCTAAT
AATTTAATGAACCCTCCTTATTTTGATTTTTTATAAGGTGCTCATATAAAGGTCTAACAA
AATAAAAACAACTAAAATGACAACAACAAGCAGGAATAGCAATCAGAAATTACAACTTAA
CCAAATTCTCTTAATTCTCCGCAAACAAACATTGATAAAAAGTAAGATGAAAATTAAGAA
AATCAAACAAATTAATAGGACGGCAGCGAACCAAGCAAATGA


>TTHERM_00221110(protein)
METAIMQQEQLYPRVHNIQQTASNHSEEEDLSTIPCLISVKKSHSTPQNSLADKINQFSD
RQQQQKEKELQEIKEQEKVETSNEEQVINRNKQNSAQQQKKKQEKDVEMRKISTAASEEL
KTDYPQQLSKSNSSSQCNLLDYKNTLIDSNDQKSDIMAKQENQTNIQRQEESKKLQTLYQ
ESSEKNKLFEEKIRKSIKEFALDKYSHFVLILVLDIGSSGHKRIIIESTLKEKELFSHEQ
FGHKILNKCIEVSKKEFIDQYNEFIKYILDNQSKTYQTLQNDKFGNYVIQKCLEIFDEDH
LSQLLILLNATLLIKPEQKLPNLPKESQLKDSDLCSDQYGCLIIQKLIEIYKTKPDSKIK
KQVGQMIEKVINDSHRLAQRQFSNYVVQQIIEKGAPEHKNMLYQNVISKHFISLAMDKYG
SNVAEKAIKYAEPDQKKQIWGLISANNFSALLNMVNDQYANYVVQRIFDSCSNKEQKQIH
QQLNLWSKKNLLKENGKHPFKYIDDLLRQNEFHNNSNNSFRSNQGKMVAQGNFSTNNNQH
SYQNRNNQNMMHNNQKQSQHFNNQNMNMEYNQTMKQTNYGLVNKNNFNQKNQNQHQNVNQ
PNFNQKHRQNNINNSSNNQMTSQMKNPQIQNNQNQESPSSNKQVQKYDQNNFNKTSNRKQ
SIHNNQQQFQNVNNNNFSYNKNQNVEPNQSQGQQNNNYDVQIKNGNTNNNNYSSYNNQYS
SHGKRNQQGNYNSQQTNSNRPYRRQNNHRGNYNYHNPIYYQSYPQQYFMQQPYFGFTPYI
YVNQPSEFTDPQLLNYFDPNNLMNPPYFDFLQGAHIKVQQNKNNQNDNNKQEQQSEITTQ
PNSLNSPQTNIDKKQDENQENQTNQQDGSEPSK


>TTHERM_00221110(gene)
ATGGAAACCGCAATAATGTAGCAAGAGTAATTGTATCCTAGAGTACATAACATTCAGCAA
ACTGCCAGTAATCATTCTGAAGAAGAAGATTTAAGCACAATCCCTTGCTTAATATCAGTG
AAAAAGTCGCATTCGACTCCTCAGAATAGCTTGGCTGATAAAATTAATCAATTTTCTGAT
CGCCAATAGCAGTAGAAAGAAAAAGAATTGCAAGAGATAAAAGAATGTATTATTTCAAAT
ATAAATTTATCATTAAGCATTTTCAATAATCGATTTTATTGTAATAAAAGAGGAGAAAGT
AGAAACATCAAATGAAGAGCAAGTGATCAAGTAAGATTATTTATAAATTTTGCATGAATT
TTTGGTTAGTTTCAGCGCAAATATTTTCATAGATGTTAAATCTCTTTTGCTATTTTGTTA
GTATTTAGAGATCATTTATTAGATTTGGTATTGGTTAATTCATTAATAAATTGAATGGAA
AAATTAATTGAAATCAATAATTGTGCAAAACAAAACATAAGAGAAAAATTTATTAATTTC
TAATACTAAATTTTGAAAAATTAAAAACTAAAGTAGAAACAAGCAAAACTCAGCTCAATA
ATAAAAGAAGAAATAAGAAAAAGATGTAGAAATGAGAAAAATTTCTACTGCAGCCTCTGA
AGAATTAAAAACTGATTACCCTCAGCAACTTAGCAAAAGCAATTCAAGTTCTTAGTAATA
GACAATTTTGTTTTTATTTTTTTATTTTCTGCATAATTCAAAATAGTAAAATAAGCAATT
AGTGTAGCTTTTCTTAGCGACATTAAAAGCAAGCGATTTCTTTCCTCCTTTTTTTCCTGA
TTAATTTTTTTAAAGGAGACTCCTTATCTAATCCTCCTTTCTCTTTTCTCTTCAAAATAT
ATTAGAAAAGATCGGCTCTTAGTTGATAGAATTTGAAATCATCATTTTTCAGCTCTTCTC
ATTTTCTTTCTCTTTTTTCACCCTACTTTCTTTATTTCCTTTATTTTTTTTGCAGCAAAA
CTCAATCATCTACTTTGACTTGATTTTCACTGATTTTGAGTTTAAACTAGAAAACCTTTT
ATGTCTATCATTTATTACTTTAAATACATTCCTTTTGCACACCTATCAGGCAAATAAGCT
TTAGGCGCAGAATATTCCCTCTTTTTTAAAGTTTTATGAATTTATAAAAGAACTTAAAAT
ACCATACAACTTCTATTGTTCTAATTTCCAAAATTTTTTCTTTCCATTCTGTTTTTTATC
GAATTACTTCATTTTTCTAAGGAAAATTTACAAAGAAAACTACCATTTTTTTTAAAAAGA
TCAAATTCTGATTATTTCTTATTACTATTAGCTCTTCAATTTATTTTTCAATTTTTTGAC
TATTACCTACCATAAACAAAGACAAAATAAATTTATATTTGCTTATGTTATTTTACTATC
CAATTTAGATGCAACTTGTTGGATTACAAAAATACTTTAATTGACTCAAATGACTAAAAG
AGTGATATTATGGCCAAACAAGAAAATCAAACTAATATACAAAGACAGGAGGAATCTAAA
AAGTTATAGACGCTATATCAAGAATCAAGTGAGAAAAATAAGCTATTTGAAGAAAAAATT
AGAAAAAGCATAAAAGAATTTGCTTTGGATAAATACTCCCACTTTGTTTTAATTCTTGTT
TTAGATATAGGTATAAAAAAATTATTTTTAAAAAACTATTTTATTAAACTTACATGAAAA
AAATAATTTCATAGGCTCTTCCGGTCATAAGAGAATAATAATTGAAAGTACATTAAAAGA
GAAAGAACTATTCAGCCATGAACAATTTGGTCACAAGATTTTAAACAAATGCATTGAAGT
CTCTAAAAAAGAATTCATTGATTAATATAATGAATTCATCAAATATATTTTAGACAACTA
ATCAAAGACTTATCAGACTCTTCAAAATGATAAATTTGGTAATTATGTTATTTAAAAATG
CTTAGAAATTTTTGATGAAGACCATTTATCACAGCTTCTGATTCTTCTGAATGCAACAGT
AACTGAAATTAAATATTTTAATATCTTTATTATTCTTTTTCTAATAAAATCATTAGCTTC
TAATCAAACCTGAGCAAAAGCTTCCTAATTTACCAAAAGAAAGTTAATTAAAAGATAGTG
ATCTTTGCTCTGATTAATATGGTTGCTTAATAATATAAAAATTAATTGAAATATATAAGA
CCAAGCCTGATTCAAAAATCAAAAAACAAGTAATTTCTTAAATCAACTAATTATTATTTT
TATTTTATGCTTCTTTCAAATCAAATTAGGTGGGACAAATGATTGAAAAAGTGATTAATG
ATTCACACCGCTTAGCATAAAGATAATTTTCCAATTATGTTGTACAGCAAATAATTGAAA
AAGGTGCTCCTGAACACAAGAATATGTTATATCAAAATGTGATTTCAAAACACTTCATAA
GCTTAGCTATGGATAAATACGGAAGTAATGTAGCTGAAAAAGCGATAAAATATGCTGAGC
CAGATTAAAAAAAATAAATTTGGGGTCTGATTTCTGCTAACAATTTTAGGTAAATTAAAT
TACATTTTAAATTTTTTTTTTAGGTTTTATTTTATTTATTGTGTAAATTTAATTAGGTTT
TTATCTATTTATTTTTGATTGATTTGGATGATAAAAATTTTAATTTTTTTTTGCTAATAA
ATAGTGCTTTACTTAACATGGTAAATGACCAGTATGCGAATTATGTAGTCTAAAGAATTT
TTGATTCATGTTCTAACAAAGAATAAAAATAAATACATTAATAGCTAAATTTATGGAGCA
AAAAAAATCTTTTAAAAGAAAATGGTAAAAATTATTTACTTTTAATTAATTAAAATCGAT
AAATAATTCAATTTAATTAAAAATTAAATTTAATTAAACTATTTAAAGGTAAGCATCCCT
TCAAATATATTGATGACCTTCTAAGACAAAATGAGTTTCATAATAATTCTAACAACAGCT
TTAGAAGTAATCAAGGCAAGATGGTAGCTTAGGGCAATTTCTCTACTAATAATAACTAGC
ATAGCTATTAAAATAGAAATAATTAAAATATGATGCATAATAATTAGAAATAATCTTAAC
ACTTTAATAATTAAAATATGAATATGGAATACAACTAAACAATGAAGCAAACCAACTATG
GTTTAGTAAATAAAAATAATTTTAATTAAAAAAATCAAAATTAACATCAAAATGTTAATT
AACCGAATTTCAACTAAAAGCACAGATAAAATAACATCAACAACAGTAGTAACAACTAGA
TGACCTCTTAAATGAAAAATCCTCAAATTTAAAACAACTAAAATTAAGAGTCACCTTCAT
CTAACAAGCAAGTTTAGAAGTATGATTAAAATAATTTCAATAAAACTAGCAATAGAAAAT
AATCAATTCATAACAACTAACAACAATTTTAAAATGTAAATAATAACAATTTCAGCTATA
ACAAAAACTAAAATGTTGAACCTAACTAAAGCTAAGGATAATAAAATAATAATTATGATG
TGTAGATTAAAAATGGAAATACAAATAACAATAACTATAGCAGCTATAATAATCAATACT
CTTCCCATGGAAAAAGAAATCAATAAGGAAATTATAACTCTTAATAAACTAACAGCAACA
GACCTTATAGGAGATAAAACAACCATAGAGGAAATTATAATTATCACAATCCAATTTATT
ACCAAAGCTATCCTTAACAATACTTTATGTAATAACCATATTTTGGATTTACTCCCTACA
TTTATGTCAATTAGCCTTCTGAATTTACTGACCCATAACTTTTAAACTATTTCGATCCTA
ATAATTTAATGAACCCTCCTTATTTTGATTTTTTATAAGGTGCTCATATAAAGGTCTAAC
AAAATAAAAACAACTAAAATGACAACAACAAGCAGGAATAGCAATCAGAAATTACAACTT
AACCAAATTCTCTTAATTCTCCGCAAACAAACATTGATAAAAAGTAAGATGAAAATTAAG
AAAATCAAACAAATTAATAGGACGGCAGCGAACCAAGCAAATGA