Identifiers and Description

Gene Model Identifier

TTHERM_00558490

Standard Name

PUF2 (Pumilio-family protein 2)

Aliases

PreTt07945 | 73.m00189 | 3735.m00083

Description

Pumilio-family RNA binding repeat containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00558490

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14415.19.997093137033517e-262pumilio-family RNA binding rep
eat containing protein (916 aa
)
OxytrichaContig14151.0.g556.9991332754409754e-68Pumilio-family RNA binding rep
eat
WormBaseWBGene000042455.000891205279872e-66locus:puf-9 status:Partially
_confirmed UniProt:Q23191
protein_id:CCD69461.1
SGDYLL013C3.0012565309061457e-65PUF3 Protein of the mitochondr
ial outer surface, links the A
rp2/3 complex with the mitocho
re during anterograde mitochon
drial movement; also binds to
and promotes degradation of mR
NAs for select nuclear-encoded
mitochondrial proteins
DictyBaseDDB_G02797351.9994274381022833e-63pufA on chromosome: 3 position
2548824 to 2551966
Stentor CoeruleusSteCoe_179928.75651076269652e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00558490(coding)
ATGGACGATAAAGATAAGCAAAGCTTCTTATTAAAGTAGCCGCAATTTAAAGTCTACTAG
CATGCCGAACTCTTCAATGGGATTCAGAAAAAACCCGAAGAGGGTGAGCTTTTGATGGGA
GGAATATTAGATGGAGATGGAGAGGATGATATATTAGCTCTTAGGAATAGTGCAAAATCA
GCCCCACCTGATTTGTATTTGCAGTAGAAAGCTTCTCTATAATAGTAAGAGAATGATTAT
TTATACACAAAGGATTACTTTGACTATTACAAACAATCAAATAATCCGCGTCTTCAAAAA
CCACTTTATAGACATGATCAGTTGGATATAAAAAGCTTAAATAAGTAGATGAACAAATTA
AGTATAGACGATTCAACTCAATACAAACAATCTATAACCAACGCGGAATTGATTTAAAGC
ATAGGAAATTCAACCCCTCCACCTTATTAACAAGTACCATAAATGATATACCCTTAACAA
TAGTAAATTATTATGGGATAAGCAAATGAAATACCACCAATCTAAGGATCAGGAAGCCCT
GCACCAATGATTATGATGCCTCCCAACCAAATGATACAACCTCCTATTAACCTTTAATAG
CCTCCTCCTACTGTAGCTTAAAATTTTAAGAACCCACCAAATCATCAGTTTTTATAGCAG
CCGCGTCCCCAAAACTAATACAATAAATATAATCAAGGAAACATGCAACATTAACAAGGA
ATAAAGAAGACTAAATCTTATCAATAATAAGGATTTTAAGGATCAAGCTAGTAAAATATG
CATCATAATAATGGTTAACCCTTTTAGTAACCTCCTTAATTCTTAAATTAAAGCTTCCCT
ATGATGTTTTAAGCTCCTCCTCCTAATTTAGGAGCTCCAAATCAAATGCAACAATTTATT
CCTCTAGGAATGTAGCAACCTATTCAGTAATTCCCATACCAATAAAACATGATGTTTTAG
CAATAAGGATATGGACCTAATTATCCCAACATGAACTATTAAAATTAAATGAGCATGAGC
TACCCATAGAATTAAAATATAGGAAATAACGGTATGCAAAACAACATTATAAACCCCTAG
AATCCAAATATCAACAATAATAGTAACAACAACAATAATTTAAGCAATAGCCCTGGAAAT
AACAATAATAACTAGATTAATGGTGGTGGAATTAACAATAATTAAAACAATTAAAATAAC
ATAAATGTGGGTAACAATAATATTATGAGCTAAAACATGGGAAATAAAAACAATTCATAA
AATTACAACATGTAAAATAATAACAGAAATTAGCAAGGTATGAATTTGGGTGGTAAAAAG
AAACAGTTAAATTAACCAAATGGGCATATTATTTAAAACCAATTCATGTAAAGCAATCAA
AATGTCAGCAATAACAATCCAAATTAAGTTTAGAATTTGGGAAAGAGTTCCTCAACAGAT
AGTTCAAATTAGAATTTTAATTAGCTATTTCCAGATTTAATTGAGTCTTGTAAAGATTAA
AATAGCTCAAGGACAATACAAAAGCAGTTTGAAAATTCTACAATTGAAGAAAAAAATAAA
ATATTTGAAAGAATCTAACCAGAAGCATTGAATTTAATGAAGGATTAATTTGGAAATTAT
GTCATTTAAAAGCTATTTGAAAAAGGAACTATTGAACATAAAGAGAAGCTCTACTATATT
ATAAAAGGAAATGTAGAGTAACTATCCCTTCATACTTATGGTTGCAGAGTTATATAAAAG
GCTTTAGAGGAACTTAAAGAAAGACCATAAATGCAAGAAGGATTGATTTAAGAGCTAAAT
AACAAGATTATGACTTGCATTCAAGATTAAAATGGAAACCATGTTATTTAAAAATGCTTT
GAAACCTTAAGTTCTTCAAAATTGACAACAATTATTAATGAAGTCATTCAAAATATAGAA
GAGTTAGCATTCCATCCATATGGATGTAGAGTCATTCAAAGAATTTTAGAATTCTGTAGC
AATCCTGAGACTAAGAAAATATACGAAAAACTTATGACCAACTTAATTAGATTATGCGAA
TGCCAATATGGAAATTATATCATTCAGTACATCATTGAAAAAGGATAAAAACTCGAAAAA
GACGAAATTCTTTAGGTAGTAAAAGTCCATTTCGTAGATCTTTCTCTCAATAAATTTGCC
TCAAACGTAACAGAAAAATCTATTGTTTATTCTGATGAAGAATTCAAAGCTGGAGTATTG
GATGTTTTATTAAGGCCAAACAATCAAAACCATTTAGATACAGGTATAGTTAGGTTGACA
AAAAATGCCTTTGGTAACTATGTTGTGCAAAGGCTGTATGAAAAAGCATAACATGAGACA
AAACTAAGGGTTTGCTAATATTTGTTATAAAATAATGATGTTTACAACGAAGTAATCTCA
AATAGTTTTGGAAAACATGTTCTTAGCTATATTGAAAAGCACAGAGTAGATATCCCTATG
AATCAAATTTAGCAAAATGTAGGCAACATACAAAATTAAAATATGAATAACAATAATAAT
AGTGGGCCTATGAATAATAATAGCAATAATAATAACAACAACAATTACAATAATAACAGT
AACAACAATAATGGTTACAACCATCATAACAATAACAACAACAACCACCATTCATAGCAT
CATAATAATTAAAATAATAACAATAATCATATTAATCATAATAACTATAAAAAGAATTAC
AACAGTAATAACCATTATTGA


>TTHERM_00558490(protein)
MDDKDKQSFLLKQPQFKVYQHAELFNGIQKKPEEGELLMGGILDGDGEDDILALRNSAKS
APPDLYLQQKASLQQQENDYLYTKDYFDYYKQSNNPRLQKPLYRHDQLDIKSLNKQMNKL
SIDDSTQYKQSITNAELIQSIGNSTPPPYQQVPQMIYPQQQQIIMGQANEIPPIQGSGSP
APMIMMPPNQMIQPPINLQQPPPTVAQNFKNPPNHQFLQQPRPQNQYNKYNQGNMQHQQG
IKKTKSYQQQGFQGSSQQNMHHNNGQPFQQPPQFLNQSFPMMFQAPPPNLGAPNQMQQFI
PLGMQQPIQQFPYQQNMMFQQQGYGPNYPNMNYQNQMSMSYPQNQNIGNNGMQNNIINPQ
NPNINNNSNNNNNLSNSPGNNNNNQINGGGINNNQNNQNNINVGNNNIMSQNMGNKNNSQ
NYNMQNNNRNQQGMNLGGKKKQLNQPNGHIIQNQFMQSNQNVSNNNPNQVQNLGKSSSTD
SSNQNFNQLFPDLIESCKDQNSSRTIQKQFENSTIEEKNKIFERIQPEALNLMKDQFGNY
VIQKLFEKGTIEHKEKLYYIIKGNVEQLSLHTYGCRVIQKALEELKERPQMQEGLIQELN
NKIMTCIQDQNGNHVIQKCFETLSSSKLTTIINEVIQNIEELAFHPYGCRVIQRILEFCS
NPETKKIYEKLMTNLIRLCECQYGNYIIQYIIEKGQKLEKDEILQVVKVHFVDLSLNKFA
SNVTEKSIVYSDEEFKAGVLDVLLRPNNQNHLDTGIVRLTKNAFGNYVVQRLYEKAQHET
KLRVCQYLLQNNDVYNEVISNSFGKHVLSYIEKHRVDIPMNQIQQNVGNIQNQNMNNNNN
SGPMNNNSNNNNNNNYNNNSNNNNGYNHHNNNNNNHHSQHHNNQNNNNNHINHNNYKKNY
NSNNHY


>TTHERM_00558490(gene)
ATGGACGATAAAGATAAGCAAAGCTTCTTATTAAAGTAGCCGCAATTTAAAGTCTACTAG
CATGCCGAACTCTTCAATGGGATTCAGAAAAAACCCGAAGAGGGTGAGCTTTTGATGGGA
GGAATATTAGATGGTTTTTATTTTTTATTTTTTTTCTTCTTCTTCTTCTTCTATTTTTTC
TCATAAAAACACTCTTTATCTTTCTAATAAAAACCCTAAATTATTTAGTTTTTTGACAAG
ACTTTATATTAATGAAATATTGAGTGGATTTATTTTTTTGAAACTACAAGCATCAATTTA
ACCTTTCTTTTTTTAATAGGAGATGGAGAGGATGATATATTAGCTCTTAGGAATAGTGCA
AAATCAGCCCCACCTGATTTGTATTTGCAGTAGAAAGCTTCTCTATAATAGGTACAATAA
CTAACTCATTTATTCATTTCTCTTTTCTCACTAAATAAATAAATACAAGCAGATTTAAAA
GAATGAAAGCCTTATAAAGAGTATAAAAGATATATTATACTCTTCTCATTGCAAGCAAAT
TTATAAATTCACAAAAATCTTTATTTTATAAAGCGTGTCCTGCGCTATGTTGCAACTGCT
GCAAAAAGCATTCCAAAATAACGCATATTATTTACTAAATTCAATTCGTTTATTAAAAAA
ATAGTAAGAGAATGATTATTTATACACAAAGGATTACTTTGACTATTACAAACAATCAAA
TAATCCGCGTCTTCAAAAACCACTTTATAGACATGATCAGTTGGATATAAAAAGCTTAAA
TAAGTAGATGAACAAATTAAGTATAGACGATTCAACTCAATACAAACAATCTATAACCAA
CGCGGAATTGATTTAAAGCATAGGAAATTCAACCCCTCCACCTTATTAACAAGTACCATA
AATGATATACCCTTAACAATAGTAAATTATTATGGGATAAGCAAATGAAATACCACCAAT
CTAAGGATCAGGAAGCCCTGCACCAATGATTATGATGCCTCCCAACCAAATGATACAACC
TCCTATTAACCTTTAATAGCCTCCTCCTACTGTAGCTTAAAATTTTAAGAACCCACCAAA
TCATCAGTTTTTATAGCAGCCGCGTCCCCAAAACTAATACAATAAATATAATCAAGGAAA
CATGCAACATTAACAAGGGTAATTAATTAATATATTCATAAATCAAAGCTTACAGTTTTA
AAAAAATGGTTTTTGTTTAAAAAAATAATTATTTATTCATTTAATTAATTAATTAACTAT
TTTTGGATGAAGTTTTTATAAAAAAAAATTTGATAAATAAATAAAAGTCAATAAAGAAGA
TTTCTTTTCTTCAATATTTTATAATAATTGATTACCTTTAAACTGAATTGAAATCCATCC
TCACTTTCTATATTTATTATAAATAAATAAATAAATAGATATCTATCTATCTATTATTTT
TTCAAGATAGACTATTAAATAATCAGCAAATAGGTCAATCAAAAAATTGTCAAGTTTGTT
TTTATTATTCTCCTTCCTAACCTTTAGTTTGATTGATTCATATGCTTTATATTTATTTAT
TTATTTATAATATCTTATTGATTTAAAGGTTATATCTTACATTCAAAAGAGTGTTTTTAA
ATTTTTAAATAAAATTTCTTTCACTAATTTTATTTAATTTTAAATAGACATTGAAATAAT
ATTATCAATTTTATAAAATTAGAATAAAGAAGACTAAATCTTATCAATAATAAGGATTTT
AAGGATCAAGCTAGTAAAATATGCATCATAATAATGGTTAACCCTTTTAGTAACCTCCTT
AATTCTTAAATTAAAGCTTCCCTATGATGTTTTAAGCTCCTCCTCCTAATTTAGGAGCTC
CAAATCAAATGCAACAATTTATTCCTCTAGGAATGTAGCAACCTATTCAGTAATTCCCAT
ACCAATAAAACATGTAAGTAAATTTTATTAGCTTACTTAATAAATAATCTTATATTAAAA
TATAATTAGGATGTTTTAGCAATAAGGATATGGACCTAATTATCCCAACATGAACTATTA
AAATTAAATGAGCATGAGCTACCCATAGAATTAAAATATAGGAAATAACGGTATGCAAAA
CAACATTATAAACCCCTAGAATCCAAATATCAACAATAATAGTAACAACAACAATAATTT
AAGCAATAGCCCTGGAAATAACAATAATAACTAGATTAATGGTGGTGGAATTAACAATAA
TTAAAACAATTAAAATAACATAAATGTGGGTAACAATAATATTATGAGCTAAAACATGGG
AAATAAAAACAATTCATAAAATTACAACATGTAAAATAATAACAGAAATTAGCAAGGTAT
GAATTTGGGTGGTAAAAAGAAACAGTTAAATTAACCAAATGGGCATATTATTTAAAACCA
ATTCATGTAAAGCAATCAAAATGTCAGCAATAACAATCCAAATTAAGTTTAGAATTTGGG
AAAGAGTTCCTCAACAGATAGTTCAAATTAGAATTTTAATTAGCTATTTCCAGATTTAAT
TGAGTCTTGTAAAGATTAAAATAGCTCAAGGACAATACAAAAGCAGTTTGAAAATTCTAC
AATTGAAGAAAAAAATAAAATATTTGAAAGAATCTAACCAGAAGCATTGAATTTAATGAA
GGATTAATTTGGAAATTATGTCATTTAAAAGCTATTTGAAAAAGGTAAGAAAGAAATATT
TTTTATTATTATGTATTTATTTAATAAAGAAGATTATAGTTTATTTTTAAGTTATAAGTT
ATTAATAAAATGTTAATATAAAATCAGATTAAAATGAGCAAAGCTTAAATAAGTATATTT
TAAAGAATAGCTAAAGTTTGTATATTTTGTTTAAAAATAATAAAATAACTTAAAACTAAC
AATTTTAATTAAGAAATTTAATTATTGATTTTAAAACAAAAGCTTAAAGTTCTTTTAATG
TTTAAATTTGTGATAGAAATTTACATTAATATGACTAAAAGAAAAAATTAATATTGAATT
TGTTTTATATTGAAATAGGAACTATTGAACATAAAGAGAAGCTCTACTATATTATAAAAG
GAAATGTAGAGTAACTATCCCTTCATACTTATGGTTGCAGAGTTATATAAAAGGCTTTAG
AGGAACTTAAAGAAAGACCATAAATGCAAGAAGGATTGATTTAAGAGCTAAATAACAAGA
TTATGACTTGCATTCAAGATTAAAATGGAAACCATGTTATTTAAAAATGCTTTGAAACCT
TAAGTTCTTCAAAATTGACAACAATTATTAATGAAGTCATTCAAAATGTAAACTTAGAAT
TATAAAATAAATATCTCTTCAATAAAAATAAATTTTATTAAAAGATAGAAGAGTTAGCAT
TCCATCCATATGGATGTAGAGTCATTCAAAGAATTTTAGAATTCTGTAGCAATCCTGAGG
TAATTTATTCATAAACTAAACATTTTGAAGTTAAAGGCATTTATTTCTTAATAGACTAAG
AAAATATACGAAAAACTTATGACCAACTTAATTAGATTATGCGAATGCCAATATGGAAAT
TATATCATTCAGTACATCATTGAAAAAGGATAAAAACTCGAAAAAGACGAAATTCTTTAG
GTAGTAAAAGTCCATTTCGTAGATCTTTCTCTCAATAAATTTGCCTCGTAAAATTTTATT
ATTTTTAATTGTTTTATATTAATGCTGAAATAAAAAAAAGAAACGTAACAGAAAAATCTA
TTGTTTATTCTGATGAAGAATTCAAAGCTGGAGTATTGGATGTTTTATTAAGGCCAAACA
ATCAAAACCATTTAGAGTAATTAATTATAAATATAACTTTTTAACTTATTTGCTACAGTG
TTAAATTAAATTTAAAAATTTAATAAAAAATAGTACAGGTATAGTTAGGTTGACAAAAAA
TGCCTTTGGTAACTATGTTGTGCAAAGGCTGTATGAAAAAGCATAACATGAGACAAAACT
AAGGGTTTGCTAATATTTGTTATAAAATAATGATGTTTACAACGAAGTAATCTCAAATAG
TTTTGGTATGCATTTTTTAATATAAAATAAAAAGCTATGAGAATAATTATTTTGATTTTA
TTGAATTAAAAATATTTAAGATAATAAATTTGATTGTGATTATTATTAATTAAAATTAAT
AGGAAAACATGTTCTTAGCTATATTGAAAAGCACAGAGTAGATATCCCTATGAATCAAAT
TTAGCAAAATGTAGGCAACATACAAAATTAAAATATGAATAACAATAATAATAGTGGGCC
TATGAATAATAATAGCAATAATAATAACAACAACAATTACAATAATAACAGTAACAACAA
TAATGGTTACAACCATCATAACAATAACAACAACAACCACCATTCATAGCATCATAATAA
TTAAAATAATAACAATAATCATATTAATCATAATAACTATAAAAAGAATTACAACAGTAA
TAACCATTATTGA