Identifiers and Description

Gene Model Identifier

TTHERM_00535890

Standard Name

PUF1 (PUmilio-family protein 1)

Aliases

PreTt03174 | 69.m00216 | 3718.m00078

Description

PUF1 pumilio-family RNA-binding repeat protein; Pumilio-family RNA binding repeat containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00210 ) Ferritin-like domain
  • ( PF00806 ) Pumilio-family RNA binding repeat
  • ( TIGR00213 ) D,D-heptose 1,7-bisphosphate phosphatase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00535890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11150.19.997093137033517e-262pumilio-family RNA binding rep
eat containing protein (707 aa
)
OxytrichaContig474.1.g522.9993110246221282e-28Pumilio-family RNA binding rep
eat
SGDYGL014W2.0002795641672355e-21PUF4 Member of the PUF protein
family, which is defined by t
he presence of Pumilio homolog
y domains that confer RNA bind
ing activity; preferentially b
inds mRNAs encoding nucleolar
ribosomal RNA-processing facto
rs
DictyBaseDDB_G02899877.997402223525235e-19DDB_G0289987 on chromosome: 5
position 3515224 to 3518414
WormBaseWBGene000042450.000000000000004001928599951003locus:puf-9 status:Partially
_confirmed UniProt:Q23191
protein_id:CCD69461.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00535890(coding)
ATGTAAATATAATAGTATAATTAAGCTATTTTCGTTAATCTTAATTATAAAGTAGGTACA
TCAAGTTCTAAAAACGCATTTGGAAATGGTCTTTTTATTTAAGATGATTTCAAAGCAAAC
GTGCCAGCTGATGTAAAAAAGATATTCTCGAGCGATGATGATAATTTAGGAAGTATATCT
ACTAATTAAAATGATTTTGTCCTATCAGGATTTGATGAAGAAGAAAATGAATCTGAATCG
ATCTATAAGACATGTAGCGAGACATTACAAACATTGCCTTTATAAATCTGCCCTTATTGC
CTCAAATTGGTGAATGAGATTCCTTATAAGATTGTAGAATTTCACAAATTAAAAGAAAAA
AAATTTGCAATTCATAAGTAATGTGACGAAGGAATCATTAGATTAAAGAACTAATATGAG
TTTGTCAACACTATGTATACCTTTTAGTAGAATGAAGGACGGCTTTTTTCAAGTAGCTAT
TCTTAAGTTGGAAGACCAAAATTGCATTAGTCTCATCTAATTATGGTTGAAATATAACAT
CCGATATCAAATGCAACAATATTTAGTATTCAATAAATTTCTGATCTTTATCAGAGCCCT
CATTCTATGAATAATGACTATATAAAGCTTAACTTAAATTCAGGTCAGTTATATTAACCT
TAATAATACATCGTTCCTATACATATATTTAGTTTAAGATCGACGGTCATTAACCTTGAA
GATAGAAAACACTTTGTAATTGATATGGTTATAAATCTTTCTTAGTTTGAAGATGGCACA
GAATTAGAATTAAAAGGGAGAAAAGATGAAGTAGGAGAATTAAAGGTGTGCGGAATAGTT
TTGGAAAAAAATATCAACAAAATTAATTCAAATAAAAATAATTACTAAATTCCATAATAA
TGGTTTTAGTAGGGTACAGGAAACAAATGTTTTGAGATATTTTCAATTGAGCTCGATTTC
ATTGATCCAGCTATTGAAAAAGTAAGAAAGACAATTCAAGAAATATTTCCTAAATTGAAT
GTTAGTAACTAACCTTATACTCCTCCTCTTTCACATGGAAGTAATTCTCCTACGTTTAGC
CCTTAAAGAGACATGAGTCCATCGACAACTGGGTGCACTACACCACCTCATGAATAATTA
ACATACTCACAAATCAAAGGCTAAATAGCAAATAAAGTTCAAAAAAATAAGGAATGGTCT
ATGGCAATCTAAATGCTCATCAAAAAGTCAGCTGAAAATAATGCTTATTATGAAATATAA
GCAGTTATAGATGAAATTAAAGGAAGATTAGTTGAATTAATGAAGCACCACTATGGAAAT
TATTTTTCTAAAACTTTAGTTTAAGTCTGTACTATGCAGCAAAAGTGCATAATACTACAA
GAAATAAAAGACATGTTCCCTGATATTTCTTAAGATCCCTAAGGAACTCATGCTATTTAA
TCTTTGGTAGAAACGATAAAGCTAGAAAATGAAAGGGAATAAATCCTTGTAATTTAGTGT
GTTGGAATGTACATTATCCCTATGACTTTAAATCCTAATGCTACTCATGTAATTAATAAA
ATCGTTCAGAACTTTACTTTAAACAATATCCTGTGTATATACGATGCAGTCATTAAAAAT
TTCAAAGAGGTGGTTAAAAATAAACAAGGAGTGTGCATTATAAAGTCTTTAATGAATAGA
TTCAAAGATACAATATAAAAAAAATAATAAATTTTATAGCTGTTAAAAGTAGATATAAGA
AATACTGTTATAGATAAATATGGAAATTATGCTCTCTAGGAGGCTATTAAAATATATCCG
AATGACGAAACAGAATTCATATGCGATTACGTTTTTGAAAACATGATTATGCTAGCATAA
AATTAGGTTTCATCTAATATCGTAGAATCGGTTTTACAGTTTTGCAAAAAGTAAAGAGCT
AAATACATTCAAAAGATTATGGAGAACATGATATTACTATTTAATGATTCATTTGGTAAA
TTTGTTATAAAGAGAGTGATAAATTTAGTGGATGTTGACAATTTCTAGATGCTTTAGTTT
AAATAGATTTTAAATTAATGTATTGCTAACAACCCAAAATAAGGAGCATTTTACACAAAC
TAAAAATCATAGATAAGTCCTAAGAGTAAAAATATGTTGAATTGA


>TTHERM_00535890(protein)
MQIQQYNQAIFVNLNYKVGTSSSKNAFGNGLFIQDDFKANVPADVKKIFSSDDDNLGSIS
TNQNDFVLSGFDEEENESESIYKTCSETLQTLPLQICPYCLKLVNEIPYKIVEFHKLKEK
KFAIHKQCDEGIIRLKNQYEFVNTMYTFQQNEGRLFSSSYSQVGRPKLHQSHLIMVEIQH
PISNATIFSIQQISDLYQSPHSMNNDYIKLNLNSGQLYQPQQYIVPIHIFSLRSTVINLE
DRKHFVIDMVINLSQFEDGTELELKGRKDEVGELKVCGIVLEKNINKINSNKNNYQIPQQ
WFQQGTGNKCFEIFSIELDFIDPAIEKVRKTIQEIFPKLNVSNQPYTPPLSHGSNSPTFS
PQRDMSPSTTGCTTPPHEQLTYSQIKGQIANKVQKNKEWSMAIQMLIKKSAENNAYYEIQ
AVIDEIKGRLVELMKHHYGNYFSKTLVQVCTMQQKCIILQEIKDMFPDISQDPQGTHAIQ
SLVETIKLENEREQILVIQCVGMYIIPMTLNPNATHVINKIVQNFTLNNILCIYDAVIKN
FKEVVKNKQGVCIIKSLMNRFKDTIQKKQQILQLLKVDIRNTVIDKYGNYALQEAIKIYP
NDETEFICDYVFENMIMLAQNQVSSNIVESVLQFCKKQRAKYIQKIMENMILLFNDSFGK
FVIKRVINLVDVDNFQMLQFKQILNQCIANNPKQGAFYTNQKSQISPKSKNMLN


>TTHERM_00535890(gene)
ATGTAAATATAATAGTATAATTAAGCTATTTTCGTTAATCGTATTATATTAAATTCAAAG
TATCTCAAATTTCAGTCCTAATAAAATAAACTATGAATATCAATTTTTTTTAGAAAAATA
GATTTTTAAAACATCTAAAATGGTATTTCAAAAATTTTTTTGTTATACTTTTTTTCTTTA
ATATAAAATTAATAATAAACCTTTTAGTAATATAATTATTACATTAAATATATCTAAAAG
CTTTTAATTTACTAGAATAATTAAAATTTTTTACTTTGATTAAATAATTAAAAAAATAAA
ATCAAAAAAGATGTGTTTAAAATATTATTTTATTTTAGAATAGTTTATAATAATATATGA
AGTAATAGATAAAAGATATATATAGATTTTACTTTTAAACTTTTAGTTGATAAAAATTTG
AAAAATAATAAAAAATTATCATTTGATATAAAATTAAAATCATAAATAATTAATGAATTC
CAGAATAAAACCTTATTTTTAATTAAAGTTAAAGATATCAATTAAAATATTTAATTTGAG
AATATAGAAAGATTAAATTTGAAAAAGGATAGAACTATGCTTTAAATCTAGATACCTCTA
TAAAACATATGTATTTAGACCACTTATTACTGAGTAATTAATATATTTTTTTTTGTTATT
GCCTGTAATGATTTATTACTTAAAAGATTAATGAAATGAAGTGAATTATAGCTTAGAGTA
AAAATAATTACAATTAAATCTTTATATAAGTTAAACACTTAAGCTAAAGTAGAAAAGAGG
AAATTAAATCTTATATAAAAACAAAATTTATATTATAAAATATCTTAAACTTTAACAAGT
AGAAAAAAGAAAGAAAAAAACACTTCAATCCAATAAGATATTTCTTTTATTAATTTTAAT
AAATAATTCTTTTATTAACATCAATTGTCCTTTTTACATTAACAAAACAATTTTATATGT
ATTTTAAAAATATCTAAATTAAATATTTTAAATTTTTTTAAGAAATTTATAAATAATTTT
AATAATTACTATTGAATTATTGATTACTAATTGATGCATTGGATATTAATGAAATTTCGT
AAAAAATAATACTTGAAAATATTACTAAAAAGTGAAATCTTAAATTGAATAAATAAATAA
TTTAATGAATAATTAATCAATCAAATAATCTATGAATAGTTTATTTTAAATAACTTTAAC
TAGTAATATTTACATAACCATATACTTAAAACATTGTAAATAAATAAACAAAGTAGGAAG
AATATTTGCAAATTAATTGATTTTAATTAAAAATAAGCAAATTGTCAAAGCAAAGATACA
TTCATATCGTTTTTGTATTTAAAAGAAAGCATTTTGCTAAATAAAGCTCACAGATTGTTA
ATTTTAAACATACATATTACTTACTTACTAGATTAGACCATTATATATTATCATAAGCTT
AGCTATACTTGTATACTCATATTAAAGTAGTTCTTAATTAGATATAATTCTTCTCTACCT
CAAATGGATAATCAGTATTTATTTTTATTATCACTTTTATTAATTTGCATTCAAAAACTT
TTTCAGTCCTACAAACAAGCAAGATCAATTTGTTAAATCATTTTTTATTTAGAAAAAGGT
TTTAAGGTATAAACTCAATTGCATTTACTCTATTATTAGGATTTTATTTCATAATTAACT
TTCGAATTGAAAGGAGCAGCGTATAGACGCATTAAATTAGTTAATTATAAAGTAGGTACA
TCAAGTTCTAAAAACGCATTTGGAAATGGTCTTTTTATTTAAGATGATTTCAAAGCAAAC
GTGCCAGCTGATGTAAAAAAGATATTCTCGAGTAAATAAAAATAAATAAATTTATTTAAA
TAATTGGTTATGTTGAGCTCTTTTAAATTTAGAAGAATCTTGTTTTTATTTATTTAATTA
TTTACTGGAAATAACAATTCAGAAAAATTTTTATAAATATGTTAAAGGCGATGATGATAA
TTTAGGAAGTATATCTACTAATTAAAATGATTTTGTCCTATCAGGATGTAAATTAGATCA
ATTGTTCAAATAAAAAAGAGAGAATATTTTTTATACAATCAAAAAAAGTTGATGAAGAAG
AAAATGAATCTGAATCGATCTATAAGACATGTAGCGAGACATTACAAACATTGCCTTTAT
AAATCTGCCCTTATTGCCTCAAATGTAATATTTTTATAACTAATATTTTAGTTTAATGAG
CGAAGAAGCGAAATACATCTGAAGCACAACCTTTTCCTTTTATTTATATTCATACAAATA
ATAATTTAAAAAGTGGTGAATGAGATTCCTTATAAGATTGTAGAATTTCACAAATTAAAA
GAAAAAAAATTTGCAATTCATAAGTAATGTGACGAAGGAATCATTAGATTAAAGAACTAA
TATGAGTTTGTCAACACTATGTATACCTTTTAGTAGAATGAAGGACGGCTTTTTTCAAGT
AGCTATTCTTAAGTTGGAAGACCAAAATTGCATTAGTCTCATCTAATTATGGTTGAAATA
TAACATCCGATATCAAATGCAACAATATTTAGTATTCAATAAATTTCTGATCTTTATCAG
AGCCCTCATTCTGTAATTACATTTAAACAAATATCATTTACAAACAAATACTTTATTTTA
AGAAGAATAAGAATTATAAATTAAAATTATTTTTAATATAAATGAGTTAATCTGAGTATT
TACTTTTTTAAAATAAAGATGAATAATGACTATATAAAGCTTAACTTAAATTCAGGTCAG
TTATATTAACCTTAATAATACATCGTTCCTATACATATATTTAGTTTAAGATCGACGGTC
ATTAACCTTGAAGATGTATTTATTATTAAAATATGAATTCAAAAAAAGTAAATGGGATTT
AAAAATATAATAGAGAAAACACTTTGTAATTGATATGGTTATAAATCTTTCTTAGTTTGA
AGATGGCACAGAATTAGAATTAAAAGGGGTAAAATATACAAAAAATAATATTGAGTAATA
GTTTTAATTAATTAATAATTTACTTATTTAGAGAAAAGATGAAGTAGGAGAATTAAAGGT
GTGCGGAATAGTTTTGGAAAAAAATATCAACAAAATTAATTCAAATAAAAATAATTACTA
AATTCCATAATAATGGTTTTAGTAGGGTACAGGAAACAAATGTTTTGAGATATTTTCAAT
TGAGCTCGATTTCATTGATCCAGCGTAAATAATGAATTTGCATTTATAACATTTAACAAT
AAGTTAATTTTAAAGTATTGAAAAAGTAAGAAAGACAATTCAAGAAATATTTCCTAAATT
GAATGTTAGTAACTAACCTTATACTCCTCCTCTTTCACATGGAAGTAATTTACATAAAAC
TAATAAATATTACAAAATTTATAATTTATGAAATTGTAGGTAATTCTCCTACGTTTAGCC
CTTAAAGAGACATGAGTCCATCGACAACTGGGTGCACTACACCACCTCATGAATAATTAA
CATACTCACAAATCAAAGGCTAAATAGCAAATAAAGTTCAAAAAAATAAGGAATGGTCTA
TGGCAATCTAAATGCTCATCAAAAAGTCAGCTGAAAATAATGCTTATTATGAAATATAAG
CAGTTATAGATGAAATTAAAGGAAGATTAGTTGAATTAATGAAGCACCACTATGGAAATT
ATTTTTCTAAAACTTTAGTTTAAGTCTGTACTATGCAGCAAAAGTGCATAATACTACAAG
AAGTAAAGCATTATAAATTTTATTTTCTATTTTGAATAAATAATTTACATAGATAAAAGA
CATGTTCCCTGATATTTCTTAAGATCCCTAAGGAACTCATGCTATTTAATCTTTGGTAGA
AACGATAAAGCTAGAAAATGAAAGGGAATAAATCCTTGTAATTTAGTGTGTTGGAATGTA
CATTATCCCTATGACTTTAGTAATGAAAAATACATTCTTATAAAAATTTTAATAAAGCAA
TTTTTTATAATTTTAAAGAATCCTAATGCTACTCATGTAATTAATAAAATCGTTCAGAAC
TTTACTTTAAACAATATCCTGTGTATATACGATGCAGTCATTAAAAATTTCAAAGAGGTG
GTTAAAAATAAACAAGGAGTGTGCATTGTAAATTTTTATAGTTTTCTAAAATTTATTTTT
TCTAAACTGATTTTATTGAATTATAAATAAATAAACAGATAAAGTCTTTAATGAATAGAT
TCAAAGATACAATATAAAAAAAATAATAAATTTTATAGCTGTTAAAAGTAGATATAAGAA
ATACTGTTATAGATAAATATGGAAATTATGCTCTCTAGGAGGCTATTAAAGTAAAAAAAA
AAATTGTATTATTATCAATTCAATTAATTAAATATTTTATCACAGATATATCCGAATGAC
GAAACAGAATTCATATGCGATTACGTTTTTGAAAACATGATTATGCTAGCATAAAATTAG
GTTTCATCTAATATCGTAGAATCGGTTTTACAGTTTTGCAAAAAGGTAATAATAATATTT
TTTTATTTTAGAAAGATTAAAATTAACCTATTAAATAAACAAATAAAAATAGTAAAGAGC
TAAATACATTCAAAAGATTATGGAGAACATGATATTACTATTTAATGATTCATTTGGTAA
ATTTGTTATAAAGAGAGTGATAAATTTAGTGGATGTTGACAATTTCTAGATGCTTTAGTT
TAAATAGATTTTAAATTAATGTATTGCTAACAACCCAAAATAAGGAGCATTTTACACAAA
CTAAAAATCATAGATAAGTCCTAAGAGTAAAAATATGTTGAATTGA