Identifiers and Description

Gene Model Identifier

TTHERM_01030010

Standard Name

PTK1 (Protein Tyrosine Kinase)

Aliases

PreTt10831 | 204.m00060

Description

Putative insulin receptor-like tyrosine kinase; 66 kDa ciliary membrane protein, tyrosine phosphorylated in response to insulin; sequence similarity to DAF2, a C.elegans insulin receptor; contains SH2/SH3 domain binding motifs

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01030010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10498.19.997093137033517e-262protein kinase domain-containi
ng protein (557 aa)
OxytrichaContig16193.0.g773.000712232670428e-104Protein kinase domain
DictyBaseDDB_G02708147.999270105144775e-57nek2 on chromosome: 1 position
4847143 to 4848761
Stentor CoeruleusSteCoe_110574.590938473882946e-48
SGDYAR018C2.0000236365077126e-43KIN3 Nonessential serine/threo
nine protein kinase; possible
role in DNA damage response
WormBaseWBGene000089562.0008536325002377e-42locus:nekl-3 status:Confirme
d UniProt:G5EFM9 protein_i
d:CAA92169.2

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16850526: Csaba G, Kovács P, Pállinger E (2007) Effect of starvation on insulin production and insulin binding in Tetrahymena. Cell biochemistry and function 25(4):473-7
  2. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810
  3. Ref:12546802: Christensen ST, Guerra CF, Awan A, Wheatley DN, Satir P (2003) Insulin receptor-like proteins in Tetrahymena thermophila ciliary membranes. Current biology : CB 13(2):R50-2

Sequences

>TTHERM_01030010(coding)
ATGCAAAATTCACAATCTCAAATTACTGACTTTGAAATACTAAAGCGTCTTGGTGAAGGT
TCTTTTGGGTCTGTCTACTAGGTTAAGAGAAAAAGTGATGAGAAGATTTATGCCATGAAA
AAGGTTAAAATGATGTCTCTTTCAACCAAGGAAAAGGAGAATGCCTTAAATGAAGTGCGT
ATCCTTGCTTCCATCAAAAGCGACAATATTATCAGCTACAAAGAAGCTTTTTATGACGAA
AAGTCATCCACATTATGCATAATCATGGAGTTTGCAACAAAAGGTGATGTTTTATAATAA
ATTAGTGAAAAGAAGAAGAAACATTCTTATTTTGAAGAAAACCTTATTTGGAAATATGCA
GCAGATATGCTCTTGGGACTAAAGTCCCTTCATGATATGAAAATTCTACACAGAGACTTG
AAAGGAGCAAACGTTTTCATTGCAGAAGATGGGTCATTAAAGCTTGGAGATTTGAATGTT
TCCAAAGTTTAAAAGAGAGATTTTGCCTACACCTAAACAGGAACACCATATTATACCTCT
CCTGAAGTTTGGTAAAATCGTCCATATGATTCTAAATGTGATGTCTGGTCTTTAGGATGT
GTATTATATGAAATAGTCACTCTTGAACCACCCTTTAAAGGCACTTCCATGGAAGATCTC
TATAAAAGAGTCTTGAGAGGCAACTTTTCTCCAATCAACTTGTAAAGATACAGCTCTGAC
CTCTAGAAGTTCATCGAGTCATGCTTAAAAGTTGAGCCTAAAATGAGATCTTCAGTAGAG
TCTCTATTAAACCATAAGTGCATAATGCCTCATCTAAAACCAGAACAGATAGCCATGCTC
GAAAAGAAGAAAAAGGAAAAAATAGATTTATTGCAGACCATCAAGCTTCCTTATGGAAAC
AACTTGAAAGAAATTAACAAGCGCTTACCCAAATCAAATTATGACATATTAGATGAAAAA
ATAGAAGAATATGAGCAAGAAATAAAAACTGATTAAATTCGTCTTAAGAAAAAAAATGAA
GACCGTCCCTACTCAGCAGTGGATCCTACAAGTAATTTAATAAAAAATAACTTAGCATAA
AAGCCAAGCGAAAACCCAATTTAAAGACCTAGAGATAATTCAGCCCATAACAACAACAAC
AACAATAATAATAACTATTATAATTATTCTCCACAACCAAATAATAGATTATAGTCAGCT
CAACCCTAAGTAAAAAGAGTTTTAAGCAATAACGATCTAGGAGTTATTAATAATCCAGGA
AAGTACTATATGCCTCCAATTGGCAATAATTAACAAAAATACAATTATCACTATTATAAT
TAAGAGAAGCCTTATTAACCTAAAATTGCGATCCACTAGCAAAAAGACTCAGTTTACAAT
AATGGCGGAATTCAAAGATATAACTCAAAAGAGGTACTTTATAAAAATGCTGAATAAATT
GTTGGAAGAGTCAGAAAATCTACCGATGATCTATTAGAAAATAATAGAAATTATGTTAAC
CAAAGACCTCCTTCTAATTATTATTCTAATGATAATAAAGGTATTCCAAAACCAAAACTC
CAACCCTTAAATAACATTCCTAAAATTCCTGGCTCACCTTAAGTCAATAACAATGCAAAT
TTACCACCAAAACCATTCAGAAATTATTGA


>TTHERM_01030010(protein)
MQNSQSQITDFEILKRLGEGSFGSVYQVKRKSDEKIYAMKKVKMMSLSTKEKENALNEVR
ILASIKSDNIISYKEAFYDEKSSTLCIIMEFATKGDVLQQISEKKKKHSYFEENLIWKYA
ADMLLGLKSLHDMKILHRDLKGANVFIAEDGSLKLGDLNVSKVQKRDFAYTQTGTPYYTS
PEVWQNRPYDSKCDVWSLGCVLYEIVTLEPPFKGTSMEDLYKRVLRGNFSPINLQRYSSD
LQKFIESCLKVEPKMRSSVESLLNHKCIMPHLKPEQIAMLEKKKKEKIDLLQTIKLPYGN
NLKEINKRLPKSNYDILDEKIEEYEQEIKTDQIRLKKKNEDRPYSAVDPTSNLIKNNLAQ
KPSENPIQRPRDNSAHNNNNNNNNNYYNYSPQPNNRLQSAQPQVKRVLSNNDLGVINNPG
KYYMPPIGNNQQKYNYHYYNQEKPYQPKIAIHQQKDSVYNNGGIQRYNSKEVLYKNAEQI
VGRVRKSTDDLLENNRNYVNQRPPSNYYSNDNKGIPKPKLQPLNNIPKIPGSPQVNNNAN
LPPKPFRNY


>TTHERM_01030010(gene)
ATGCAAAATTCACAATCTCAAATTACTGACTTTGAAATACTAAAGCGTCTTGGTGAAGGT
TCTTTTGGGTCTGTCTACTAGGTTAAGAGAAAAAGTGATGAGAAGATTTATGCCATGAAA
AAGGTTAAAATGATGTCTCTTTCAACCAAGGAAAAGGAGAATGCCTTAAATGAAGTGCGT
ATCCTTGCTTCCATCAAAAGCGACAATATTATCAGCTACAAAGAAGCTTTTTATGACGAA
AAGTCATCCACATTATGCATAATCATGGAGTTTGCAACAAAAGGTGATGTTTTATAATAA
ATTAGTGAAAAGAAGAAGAAACATTCTTATTTTGAAGAAAACCTTATTTGGAAATATGCA
GCAGATATGCTCTTGGGACTAAAGTCCCTTCATGATATGAAAATTCTACACAGAGACTTG
AAAGGAGCAAACGTTTTCATTGCAGAAGATGGGTCATTAAAGCTTGGAGATTTGAATGTT
TCCAAAGTTTAAAAGAGAGATTTTGCCTACACCTAAACAGGAACACCATATTATACCTCT
CCTGAAGTTTGGTAAAATCGTCCATATGATTCTAAATGTGATGTCTGGTCTTTAGGATGT
GTATTATATGAAATAGTCACTCTTGAACCACCCTTTAAAGGCACTTCCATGGAAGATCTC
TATAAAAGAGTCTTGAGAGGCAACTTTTCTCCAATCAACTTGTAAAGATACAGCTCTGAC
CTCTAGAAGTTCATCGAGTCATGCTTAAAAGTTGAGCCTAAAATGAGATCTTCAGTAGAG
TCTCTATTAAACCATAAGTGCATAATGCCTCATCTAAAACCAGAACAGATAGCCATGCTC
GAAAAGAAGAAAAAGGAAAAAATAGATTTATTGCAGACCATCAAGCTTCCTTATGGAAAC
AACTTGAAAGAAATTAACAAGCGCTTACCCAAATCAAATTATGACATATTAGATGAAAAA
ATAGAAGAATATGAGCAAGAAATAAAAACTGATTAAATTCGTCTTAAGAAAAAAAATGAA
GACCGTCCCTACTCAGCAGTGGATCCTACAAGTAATTTAATAAAAAATAACTTAGCATAA
AAGCCAAGCGAAAACCCAATTTAAAGACCTAGAGATAATTCAGCCCATAACAACAACAAC
AACAATAATAATAACTATTATAATTATTCTCCACAACCAAATAATAGATTATAGTCAGCT
CAACCCTAAGTAAAAAGAGTTTTAAGCAATAACGATCTAGGAGTTATTAATAATCCAGGA
AAGTACTATATGCCTCCAATTGGCAATAATTAACAAAAATACAATTATCACTATTATAAT
TAAGAGAAGCCTTATTAACCTAAAATTGCGATCCACTAGCAAAAAGACTCAGTTTACAAT
AATGGCGGAATTCAAAGATATAACTCAAAAGAGGTACTTTATAAAAATGCTGAATAAATT
GTTGGAAGAGTCAGAAAATCTACCGATGATCTATTAGAAAATAATAGAAATTATGTTAAC
CAAAGACCTCCTTCTAATTATTATTCTAATGATAATAAAGGTATTCCAAAACCAAAACTC
CAACCCTTAAATAACATTCCTAAAATTCCTGGCTCACCTTAAGTCAATAACAATGCAAAT
TTACCACCAAAACCATTCAGAAATTATTGA