Identifiers and Description

Gene Model Identifier

TTHERM_00670210

Standard Name

PTH3 (peptidyl-tRNA hydrolase 3)

Aliases

PreTt01045 | 100.m00106 | 3731.m00016

Description

peptidyl-tRNA hydrolase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02184 ) HAT (Half-A-TPR) repeat
  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00670210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16437.13.999622461503957e-161hypothetical protein (484 aa)
OxytrichaContig13550.0.g190.0000020007268868677913WD domain, G-beta repeat
SGDYOR272W0.0000020007268868677913YTM1 Constituent of 66S pre-ri
bosomal particles, forms a com
plex with Nop7p and Erb1p that
is required for maturation of
the large ribosomal subunit;
has seven C-terminal WD repeat
s
DictyBaseDDB_G02854450.000006997203421143941DDB_G0285445 on chromosome: 4
position 3230059 to 3233762
WormBaseWBGene000227420.000030009396760408108status:Partially_confirmed U
niProt:Q23494 protein_id:CCD
61674.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00670210(coding)
ATGATTTAATAGAGATCTGATCAGATTCTTGAAGAAGGGAGATAATAAGATATTCCAGAT
ACTTAAACTCAAAATACTTAATACACCCAGAATTATAACCATCCTTTTGAGTGGTCTCGA
GTCCTTGAAAATATCTCTGTTGTCGCTTTACAGAAGTTCACCTCATAATCTATAGGTATT
TTGAGCGATAAGCAAATAATTATGTTAAATGTTAGGACTTGCAAAATAGAAAGAAAAATA
AAGCCTAATAACAAAGCAACATGCATTACGATATTGAACTAATACTAAAATTATTCAGAG
TCATAATCACCAACCCATATTATTCCTAAAAAGAAAGTAAAGAGTTTATGCGTTTAATTT
TTTACAGGCCACTTTGATGGAACTATTACTCTCTGGGTAATCTAAAACAACAAGGTTAAA
AAGATGAGAGTATTTACTGATATTGAACCTTCTAATAGAAGACCTGTCAGCTGCTTAAAT
GTGATGAGCTTCAAATAGCACTTACCAGCTCCGCAAAAAAGGCATTGCTCAGAAAAATTA
CAAAGATGGAGAGGATCTACTTAACAACATTAAAAAACTTAGGTATAGGTAGTTGTCTAA
TATGTTTTGTTAAGTGGACACTAAAACGGAAATGTTAAACAATGGAACATACTTACAGGA
TAGTGCTTGAAGGAAATAGAAACAAAACACAACGGTATTCTCTTTTGTGTAGCGTCAATC
CAAGAGACCGTCTTAACTGGAGGCTATGATAATATCTAGGTGCACTAACCTCAAAGAGCT
AATTCTCTACCTCCCTTTTCGTCATTCTAATAATAATCCTCCTGTCAAGCTACTTCTACT
AACCAAATTTACGACAAAGTTTAAAGCAATTTCTATGAAGACTCTAAAACAAGCGAAGGA
CAAAATTTCCCATTTTCTGCTTCATAATCTAGAAAAAAATCATGGAGCAATTAAAGGGAA
GAAGAAAGAAGCAGACATATAAAAAAGGAATTCAAAGTAATCCATAAGGGATTTGCGAAC
TACTAAATAAAGCCAAACTATACATAAAAAGAAGAAAAAATAGTTAGAAACATGATTGCT
CTTGGTAGCAATTAGATTATTTCTCATGGCTTCACAAATGATGTTACGGAATGGAAATTA
GAGTCAAATAAAATGACTAAAAAAATATACACAGGTCATACAGATAATGTAAAATGCATT
GAAAAGTTAAATGGTTCTTCCTTCGTAACGGGCGGCAGAGACTCTAATGTTATAATATGG
GATAATAACACAAAATCTAATCAAATATATGAAGGAGCTCATTCGCAGCCAGTAAGTTCT
CTTTCAGCTATTGATGATAAATCATTTGTCTCTTCAGGAGAAGATAACCAAATCTTATTT
TGGAAATAATCTAAGTGA


>TTHERM_00670210(protein)
MIQQRSDQILEEGRQQDIPDTQTQNTQYTQNYNHPFEWSRVLENISVVALQKFTSQSIGI
LSDKQIIMLNVRTCKIERKIKPNNKATCITILNQYQNYSESQSPTHIIPKKKVKSLCVQF
FTGHFDGTITLWVIQNNKVKKMRVFTDIEPSNRRPVSCLNVMSFKQHLPAPQKRHCSEKL
QRWRGSTQQHQKTQVQVVVQYVLLSGHQNGNVKQWNILTGQCLKEIETKHNGILFCVASI
QETVLTGGYDNIQVHQPQRANSLPPFSSFQQQSSCQATSTNQIYDKVQSNFYEDSKTSEG
QNFPFSASQSRKKSWSNQREEERSRHIKKEFKVIHKGFANYQIKPNYTQKEEKIVRNMIA
LGSNQIISHGFTNDVTEWKLESNKMTKKIYTGHTDNVKCIEKLNGSSFVTGGRDSNVIIW
DNNTKSNQIYEGAHSQPVSSLSAIDDKSFVSSGEDNQILFWKQSK


>TTHERM_00670210(gene)
ATGATTTAATAGAGATCTGATCAGATTCTTGAAGAAGGGAGATAATAAGATATTCCAGAT
ACTTAAACTCAAAATACTTAATACACCCAGAATTATAACCATCCTTTTGAGTGGTCTCGA
GTCCTTGAAAATATCTCTGTTGTCGCTTTACAGAAGTTCACCTCATAATCTATAGGTATT
TTGAGCGATAAGCAAATAATTATGTTAAATGTTAGGACTTGCAAAATAGAAAGAAAAATA
AAGCCTAATAACAAAGCAACATGCATTACGATATTGAACTAATACTAAAATTATTCAGAG
TCATAATCACCAACCCATATTATTCCTAAAAAGAAAGTAAAGAGTTTATGCGTTTAATTT
TTTACAGGCCACTTTGATGGAACTATTACTCTCTGGGTAATCTAAAACAACAAGGTTAAA
AAGATGAGAGTATTTACTGATATTGAACCTTCTAATAGAAGACCTGTCAGCTGCTTAAAT
GTGATGAGCTTCAAATAGCACTTACCAGCTCCGCAAAAAAGGCATTGCTCAGAAAAATTA
CAAAGATGGAGAGGATCTACTTAACAACATTAAAAAACTTAGGTATAGGTAGTTGTCTAA
TATGTTTTGTTAAGTGGACACTAAAACGGAAATGTTAAACAATGGAACATACTTACAGGA
TAGTGCTTGAAGGAAATAGAAACAAAACACAACGGTATTCTCTTTTGTGTAGCGTCAATC
CAAGAGACCGTCTTAACTGGAGGCTATGATAATATCTAGGTGCACTAACCTCAAAGAGCT
AATTCTCTACCTCCCTTTTCGTCATTCTAATAATAATCCTCCTGTCAAGCTACTTCTACT
AACCAAATTTACGACAAAGTTTAAAGGTAAGTAATCATAATTATGAATTTTTCAATTAAA
AATTTATTCAAAAATAAAATAAGCAATTTCTATGAAGACTCTAAAACAAGCGAAGGACAA
AATTTCCCATTTTCTGCTTCATAATCTAGAAAAAAATCATGGAGCAATTAAAGGGAAGAA
GAAAGAAGCAGACATATAAAAAAGGAATTCAAAGTAATCCATAAGGGATTTGCGAACTAC
TAAATAAAGCCAAACTATACATAAAAAGAAGAAAAAATAGTTAGAAACATGATTGCTCTT
GGTAGCAATTAGATTATTTCTCATGGCTTCACAAATGATGTTACGGAATGGAAATTAGAG
TCAAATAAAATGACTAAAAAAATATACACAGGTCATACAGATAATGTAAAATGCATTGAA
AAGTTAAATGGTTCTTCCTTCGTAACGGGCGGCAGAGACTCTAATGTTATAATATGGGAT
AATAACACAAAATCTAATCAAATATATGAAGGAGCTCATTCGCAGCCAGTAAGTTCTCTT
TCAGCTATTGATGATAAATCATTTGTCTCTTCAGGAGAAGATAACCAAATCTTATTTTGG
AAATAATCTAAGTGA