Identifiers and Description

Gene Model Identifier

TTHERM_00689840

Standard Name

PTH2 (peptidyl-tRNA hydrolase 2)

Aliases

PreTt23180 | 105.m00147 | 3737.m00059

Description

peptidyl-tRNA hydrolase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00689840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16630.14.000347951747671e-122peptidyl-tRNA hydrolase (230 a
a)
SGDYHR189W2.000769134519826e-18PTH1 One of two (see also PTH2
) mitochondrially-localized pe
ptidyl-tRNA hydrolases; dispen
sable for respiratory growth o
n rich medium, but required fo
r respiratory growth on minima
l medium
OxytrichaContig18280.0.g792.0004286606204839e-16Peptidyl-tRNA hydrolase
Stentor CoeruleusSteCoe_326930.00000000000009357622968840175
DictyBaseDDB_G02805070.0000000000002999981760818895DDB_G0280507 on chromosome: 3
position 3459592 to 3460950

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00689840(coding)
ATGCTAACTTCAACCTTATTTATTTATATTAGTTGCATCATTTTAGGCCTCTTTATAGCG
TTATTTTCAAGTAAAAGAAAAAGAGAATTACAATAATAAAATTCTCCTTCTGCACAAAAT
ACCAAAGAAACTCCAATTTAGCTTGATAAGCTCATAATAGGTTTAGGTAATCCTGGCTAA
TAATATGAGAACATGAGACATAATGTAGGAAAATTATTTATTTCTTACACTGCTAATAAA
TTTAATGCATAGCTAAAAAAAATAAATTAAGGATACTTAGCCATTTTAAATGAAGACACT
AATCTACCTAAAATTGGTTTATTTAACACTTATTGCTATATGAACATCAGTGGAAAATCT
ATTTCTGAAGTTATAAAAAAGCACCAAGTAAAAGTAGAGAATATAATTGTTGTTCACGAT
GACTTAGATAATGCATTTGGTAAAGTAAAAATTAAAGAAGGAGGCAGTGCAGAAGGTCAT
AATGGTCTTAAGTCTATAATTGAATATTTAGATACAAAAGAGTTTTTGAGATTAAAAATA
GGCATAGATAGACCAAACTCCAGAGATCCTATTGTAATAAGTCCTTATGTCCTAGGCAAT
TTTTCAACAGATTAACAAACTAGACTTAACACTGAAATATTTGAGAAAGGAATAGAGATA
CTCAAAAATAAAAATTTTATTTAATGTTGA


>TTHERM_00689840(protein)
MLTSTLFIYISCIILGLFIALFSSKRKRELQQQNSPSAQNTKETPIQLDKLIIGLGNPGQ
QYENMRHNVGKLFISYTANKFNAQLKKINQGYLAILNEDTNLPKIGLFNTYCYMNISGKS
ISEVIKKHQVKVENIIVVHDDLDNAFGKVKIKEGGSAEGHNGLKSIIEYLDTKEFLRLKI
GIDRPNSRDPIVISPYVLGNFSTDQQTRLNTEIFEKGIEILKNKNFIQC


>TTHERM_00689840(gene)
TATAATTTTTATTTATTATTTAACAAAAATATATTCACAAATTTATGCTAACTTCAACCT
TATTTATTTATATTAGTTGCATCATTTTAGGCCTCTTTATAGCGTTATTTTCAAGTAAAA
GAAAAAGAGAATTACAATAATAAAATTCTCCTTCTGCACAAAATACCAAAGAAACTCCAA
TTTAGCTTGATAAGCTCGTAATTTAAGAATTCAATATTCTTTATTTATCTTTGCATTCTT
CAAAAAACGAAGGATTATATATAAAAATATAGATAATAGGTTTAGGTAATCCTGGCTAAT
AATATGAGAACATGAGACATAATGTAGGAAAATTATTTATTTCTTACACTGCTAATAAAT
TTAATGCATAGCTAAAAAAAATAAATTGTAATAGTTTGCTTATTAAACTGAAAATGCTTC
ATGTATTTTTAACTTGATAATTATATTTAGAAGGATACTTAGCCATTTTAAATGAAGACA
CTAATCTACCTAAAATTGGTTTATTTAACACTTATTGCTATATGAACATCAGTGGAAAAT
CTATTTCTGAAGTTATAAAAAAGCACCAAGTATTTTAAAATTTTTATTTAACACTCTTAT
TGAATAAATTTGAAAAAAAGGTAAAAGTAGAGAATATAATTGTTGTTCACGATGACTTAG
ATAATGCATTTGGTAAAGTAAAAATTAAAGAAGGAGGCAGTGCAGAGTAGGAAAATTATT
TAAAATACATTTATGAAAAACTAAAATTTATTCTAAAAAATTTAGAGGTCATAATGGTCT
TAAGTCTATAATTGAATATTTAGATACAAAAGAGTTTTTGAGATTAAAAATAGGCATAGG
TATTTATTTATTTGCTCATTCACTTATTCATTCAAATCCTTTTTATTTTAATTATATTAA
TTTTTATTAAAAAATTTTAAATATTTGCAGATAGACCAAACTCCAGAGATCCTATTGTAA
TAAGTCCTTATGTCCTAGGCAATTTTTCAACAGGTAAAATAGCAATTTATGTAAACGATA
TAAAAAATTAATTTAATTGCTAGATATTTTAAAATCGATTTCTTCTATTTAGATAATAAA
AACTCAATATAAAAATATTATTTTAACATAGATTAACAAACTAGACTTAACACTGAAATA
TTTGAGAAAGGAATAGAGATACTCAAAAATAAAAATTTTATTTAATGTTGACAAGATAGA
AACCTTAAAATTTGAATATAGTTTAGAGAA