Identifiers and Description

Gene Model Identifier

TTHERM_00487020

Standard Name

PRS1 (Prolyl-tRNA synthetase 1)

Aliases

PreTt19633 | 59.m00271 | 3680.m00128

Description

prolyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00414 ) seryl-tRNA synthetase
  • ( PF03129 ) Anticodon binding domain
  • ( TIGR00408 ) prolyl-tRNA synthetase
  • ( TIGR00409 ) prolyl-tRNA synthetase
  • ( TIGR00418 ) threonyl-tRNA synthetase
  • ( PF09180 ) Prolyl-tRNA synthetase, C-terminal
  • ( PF05727 ) Uncharacterised protein family (UPF0228)
  • ( PF04073 ) YbaK/prolyl-tRNA synthetases associated domain
  • ( PF00587 ) tRNA synthetase class II core

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00487020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_377840
WormBaseWBGene000041899.997093137033517e-262locus:pars-1 status:Confirme
d UniProt:Q22620 protein_i
d:CCD73349.1
Tetrahymena borealisEI9_12209.19.997093137033517e-262prolyl-tRNA synthetase (734 aa
)
DictyBaseDDB_G02841979.997093137033517e-262proS on chromosome: 4 position
1680128 to 1681774
OxytrichaContig15844.0.g1119.997093137033517e-262Anticodon binding domain
SGDYHR020W9.997093137033517e-262YHR020W Protein of unknown fun
ction that may interact with r
ibosomes, based on co-purifica
tion experiments; has similari
ty to proline-tRNA ligase; YHR
020W is an essential gene

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00487020(coding)
ATGATAAAAATATTAAACAGATTCGTAAGGATTCAAAAATTTAATAATAATTATTTAAAA
AATATTAATAACAATTAAAATTTCTATAGCATTCATTAAAAATATCTTAATCACTTTTCA
AGGAAAATGGCTGAGAGCAAATTATACCTCACAAAGGACGAAACTTGCGATTACTTAAAA
AGCATTAATTTCGAATTTAAGAGATACGATCACGAACCTTGCTTTAATGTTGAAGATATG
CATAAATACTTAAAGCTCGAAAAGGCTCCTTTAATTAAGAATCTCTTCTATCAAGACAAG
AAGGGTAACTATTATTTAGTTGTAGCTAAGCATGATACTAAAGTTGAAAAAACTTTATGG
AAGTAAGTCAATCTTGCTCCTGGTAACATGCGTTTAGCTGCTGATGAAAAGCTTGAGGCT
GTTTTGAAGGTCAAGAGAGGACATGTTAATCCTTTCGCCTTAGTTAATGATACTGAAAAG
TTAGTTAAAGCTTTAATTATCGATGAACATTTGAAGAAAGAAGAATATTGGGCTTTCCAT
CCTATGGATAATTCTGCTTGCGTTGAATTCAAGCAAACTGAATTCTAAAAGTTTATCGAT
GCTATTGGCAGAACTTTTGTTCACGTGAGACTCGACTTATCTGAAGAAGAAGAGAAAAAG
CTCGCAGAATAAGCAAAGAAGGAAACTGCTAAAGTTGAAGAAGCTGGTCATACTAAATTA
GGTATTGATGTTAAAAAAGATCAAGATTTATCTGAATGGTACAAGCAAGTTATCACTAAA
TCTGAAATGATCGAATATTATGATATCTCTGGTTGCTACATTCTTCGTCCCCACGCTTAT
GCCATCTGGGAAATCATTTAGAGATTCTTTGATGACATCATCAAGGGATTCGATGTACAA
AATGCTTATTTCCCTATGTTTGTCACTGATAAGGCTTTAAACAAAGAAAAGGAACACGTT
GAAGGTTTCTCACCTGAAGTTGCTTGGGTTACTAGAAGTGGTTCCACTGATTTACCTGAA
CCTATTGCAGTTCGTCCTACATCAGAAACAATTATGTATCCTGCTTACTCCAAGTGGATC
AAGTCTCACAGAGATCTTCCCTTGAAATTAAACTAATGGACTAACGTAGTCCGTTGGGAA
TTCAAGGATCCTACTCCTTTCATTAGAACAAGAGAATTCTTATGGTAAGAAGGTCACACC
GCTCATGCCACTGATGCTGAAGCCACTGAATTTACTTTCCTTATCTAAGATTAATACAGA
AGAGTCTACGAAGAACTCCTTGCTGTTCCTGTTATCAAGGGTGTCAAGAGTGAAAATGAA
AAATTCCCTGGTGCTTACTTCTCTTCCACTATTGAAACTTGCATTCCTGCTAATGGTCGT
GCTGTCTAAGCTGCCACTTCTCACCACTTGGGATAAAACTTCTCAAAGATGTTTGATATT
TCCTTCTTAGATGGTGAAAAAAAGAAATAATACGCCTACCAAACTTCCTGGGGTCTTACT
ACTCGTACTATTGGTGTTATGATTCTTTATCACGGTGATGATAAGGGTCTTGTTTTACCT
CCTCTTGTTGCTAGCACTCAAGTTGTTATCGTTCCAATTATTAAAACCGGAGCTGATAAC
GAAAGAGTTTTAAACAAAGCTCATGAATTAAAGGCTGAATTAAAGAAGGCTGGTATCAGA
GTTTAGGTTGATGACAGAGATAACTATACTTCTGGTTGGAAATTCAACCATTGGGAAGTC
AAGGGTATTCCTTTAAGATTTGAAATTGGTCAAATGGATATGGATAAGAATTAAATTACA
GCAGTTTGGAGAGTCAACTCTCACAAGGAAGCTATTCCTAACGAAAGTATTATTGAAACT
ACTAAGTTAAGATTGAAAGAAATACAAGATTTAATGTTAACTAACTCCAAGAAAAAGTTT
AACGATAAGATTAAGCCTGCTAGTACCTGGGCTGAATTCATGACTTCTCTTAACTCTCGT
TGCATTGTCTATACTCCTTGGTGCAATGAAATTTCATGTGAAAAGGCTGTTAAGGAAAGA
TCAGCTCTTGAATCTAAGGGAACAGAAAATGAATCTGGTTTATCTGGATCTGCAAAGACT
TTGTGCATTCCTAATGAATAAGAACCTATCGCTGAAGGCACTAAGTGTTTCTCTTGCGGA
AAGCCTGCTCTTAAGAGAGTTTATTGGGGAAGATCTTATTGA


>TTHERM_00487020(protein)
MIKILNRFVRIQKFNNNYLKNINNNQNFYSIHQKYLNHFSRKMAESKLYLTKDETCDYLK
SINFEFKRYDHEPCFNVEDMHKYLKLEKAPLIKNLFYQDKKGNYYLVVAKHDTKVEKTLW
KQVNLAPGNMRLAADEKLEAVLKVKRGHVNPFALVNDTEKLVKALIIDEHLKKEEYWAFH
PMDNSACVEFKQTEFQKFIDAIGRTFVHVRLDLSEEEEKKLAEQAKKETAKVEEAGHTKL
GIDVKKDQDLSEWYKQVITKSEMIEYYDISGCYILRPHAYAIWEIIQRFFDDIIKGFDVQ
NAYFPMFVTDKALNKEKEHVEGFSPEVAWVTRSGSTDLPEPIAVRPTSETIMYPAYSKWI
KSHRDLPLKLNQWTNVVRWEFKDPTPFIRTREFLWQEGHTAHATDAEATEFTFLIQDQYR
RVYEELLAVPVIKGVKSENEKFPGAYFSSTIETCIPANGRAVQAATSHHLGQNFSKMFDI
SFLDGEKKKQYAYQTSWGLTTRTIGVMILYHGDDKGLVLPPLVASTQVVIVPIIKTGADN
ERVLNKAHELKAELKKAGIRVQVDDRDNYTSGWKFNHWEVKGIPLRFEIGQMDMDKNQIT
AVWRVNSHKEAIPNESIIETTKLRLKEIQDLMLTNSKKKFNDKIKPASTWAEFMTSLNSR
CIVYTPWCNEISCEKAVKERSALESKGTENESGLSGSAKTLCIPNEQEPIAEGTKCFSCG
KPALKRVYWGRSY


>TTHERM_00487020(gene)
TTAAAAAAAGTAAATGATAAAAATATTAAACAGATTCGTAAGGATTCAAAAATTTAATAA
TAATTATTTAAAAAATATTAATAACAATTAAAATTTCTATAGCATTCATTAAAAATATCT
TAATCACTTTTCAAGGAAAATGGCTGAGAGCAAATTATACCTCACAAAGGACGAAACTTG
CGATTACTTAAAAAGCATTAATTTCGAATTTAAGAGATACGATCACGAACCTTGCTTTAA
TGTTGAAGATATGCATAAATACTTAAAGCTCGAAAAGGCTCCTTTAATTAAGAATCTCTT
CTATCAAGACAAGAAGGGTAACTATTATTTAGTTGTAGCTAAGCATGATACTAAAGTTGA
AAAAACTTTATGGAAGTAAGTCAATCTTGCTCCTGGTAACATGCGTTTAGCTGCTGATGA
AAAGCTTGAGGCTGTTTTGAAGGTCAAGAGAGGACATGTTAATCCTTTCGCCTTAGTTAA
TGATACTGAAAAGTTAGTAGGGATAAATTCTTTAATTTCAATTCAAAAGCTCAATTTTCC
ATTTTAAAGTTAAAAATTTGAATTATTATGATCAAAAAAAGATGAATGAGAATAAGCATA
TTATTTGCACCCATAAATTATCAAACACCTAATAAAAATATCAAACTTATACAATAAGTT
TTTTAAAATGAGCGAAAATAGTGTTAATAAAATCACATTGTGAATACGTAATTTAGCATA
AGACTTATGAAAATGTATTTTTAATAAAAAGGTTAAAGCTTTAATTATCGATGAACATTT
GAAGAAAGAAGAATATTGGGCTTTCCATCCTATGGATAATTCTGCTTGCGTTGAATTCAA
GCAAACTGAATTCTAAAAGTTTATCGATGCTATTGGCAGAACTTTTGTTCACGTGAGACT
CGACTTATCTGAAGAAGAAGAGAAAAAGCTCGCAGAATAAGCAAAGAAGGAAACTGCTAA
AGTTGAAGAAGCTGGTCATACTAAATTAGGTATTGATGTTAAAAAAGATCAAGATTTATC
TGAATGGTACAAGCAAGTTATCACTAAATCTGAAATGATCGAATATTATGATATCTCTGG
TTGCTACATTCTTCGTCCCCACGCTTATGCCATCTGGGAAATCATTTAGGTAATACATTT
TACAATATTTTTACTACATTTAAAAAAGCTAGATCAGAAAAAAATAAAAAAGATTATTTA
TATATTTCTAAACGTTCTTCATAAAAAAATTAAATTATTGCGAAGTTAGTTAATAGTATA
TCTAAAATATATCAAAAATAAATAGATATTAGTTAGTTAGTAAGCGAAAAAATAAATCTT
TTTAAAAGAACGCGAAAAAAATTGATAGAAAATTTAGATTTAATTTGTCTAATCTGAAAA
TTTTGAACTTTTTTTATTTTTTTGTTAAATTTAAATTTCAATTAAAAATAATAATAATAG
AGATTCTTTGATGACATCATCAAGGGATTCGATGTACAAAATGCTTATTTCCCTATGTTT
GTCACTGATAAGGCTTTAAACAAAGAAAAGGAACACGTTGAAGGTTTCTCACCTGAAGTT
GCTTGGGTTACTAGAAGTGGTTCCACTGATTTACCTGAACCTATTGCAGTTCGTCCTACA
TCAGAAACAATTATGTATCCTGCTTACTCCAAGTGGATCAAGTCTCACAGAGATCTTCCC
TTGAAATTAAACTAATGGACTAACGTAGTCCGTTGGGAATTCAAGGATCCTACTCCTTTC
ATTAGAACAAGGTATTTATTATAAATTAAAATGCTTTTAAATAACTATTAAATATTCTAA
AATCTATAGAAAGTTTTAATTTTTAAATTCAATATTTTATTAAAAATTAATATAAATTTA
TTTATTTCTTAGAGAATTCTTATGGTAAGAAGGTCACACCGCTCATGCCACTGATGCTGA
AGCCACTGAATTTACTTTCCTTATCTAAGATTAATACAGAAGAGTCTACGAAGAACTCCT
TGCTGTTCCTGTTATCAAGGGTGTCAAGAGTGAAAATGAAAAATTCCCTGGTGCTTACTT
CTCTTCCACTATTGAAACTTGCATTCCTGCTAATGGTCGTGCTGTCTAAGCTGCCACTTC
TCACCACTTGGGATAAAACTTCTCAAAGATGTTTGATATTTCCTTCTTAGATGGTGAAAA
AAAGAAATAATACGCCTACCAAACTTCCTGGGGTCTTACTACTCGTACTATTGGTGTTAT
GATTCTTTATCACGGTGATGATAAGGTAATTTTTATTTTAAAGTTAATAAATTTACATTT
AATATTTATGCAATTTGTAATTAGGGTCTTGTTTTACCTCCTCTTGTTGCTAGCACTCAA
GTTGTTATCGTTCCAATTATTAAAACCGGAGCTGATAACGAAAGAGTTTTAAACAAAGCT
CATGAATTAAAGGCTGAATTAAAGAAGGCTGGTATCAGAGTTTAGGTTGATGACAGAGAT
AACTATACTTCTGGTTGGAAATTCAACCATTGGGAAGTCAAGGGTATTCCTTTAAGATTT
GAAATTGGTCAAATGGATATGGATAAGAATTAAATTACAGCAGTTTGGAGAGTCAACTCT
CACAAGGAAGCTATTCCTAACGAAAGTATTATTGAAACTACTAAGTTAAGATTGAAAGAA
ATACAAGATTTAATGTTAACTAACTCCAAGAAAAAGTTTAACGATAAGATTAAGCCTGCT
AGTACCTGGGCTGAATTCATGACTTCTCTTAACTCTCGTTGCATTGTCTATACTCCTTGG
TAATTATTAAAGACAATAAATACAGTTTTCATTTCATATCGATTTATGAAAACTGATAAT
TAAATTTGAATATTTATTGAATTTTTCTTTTTTAATAAAAGGTGCAATGAAATTTCATGT
GAAAAGGCTGTTAAGGAAAGATCAGCTCTTGAATCTAAGGGAACAGAAAATGTAAATAAA
TAAATATAAAATCAAAATCATAGAAAATATTAAAATATTTTTAAATAATAGGAATCTGGT
TTATCTGGATCTGCAAAGACTTTGTGCATTCCTAATGAATAAGAACCTATCGCTGAAGGC
ACTAAGTGTTTCTCTTGCGGAAAGCCTGCTCTTAAGAGAGTTTATTGGGGAAGATCTTAT
TGATCGTTATTAAAACATAGATTAAGATATAAAAAACTTATCAATTTTTTAAAATATTTA
ATTATTCAGTTAAATTCGCTCTATTTTTGTTTTGTTATAATATTAAGCAAATTATTTTCA
TTCATATTTCATATTAGATAATTTCAACAATACAAATTAGTTTTTTTTCACTAAAATCTG
AAAGATTTATACTATTTTAACAACCTAAGAAAAATACCTATTCTGTTACTTCAAAATTAT
TAAAGTTATTTTTAACAATTATTATCTTCATTTATGCAAATTTAAATTCAAGATCTAAAT
CAAAGTTAACATATAATAAAACCATTATTTAAAAGAAAATTTTTATTAAAATTTAATACT
TATCATATTTTTAAATACCTAATAGTATTAATTTTAATCTTATTTTAAACTTTTAGATTA
GAG