Identifiers and Description

Gene Model Identifier

TTHERM_00649280

Standard Name

PRP9 (pre-mRNA processing factor 9)

Aliases

PreTt09242 | 94.m00160 | 3677.m00068

Description

splicesome-associated protein, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.5%

TetraMine Data

TTHERM_00649280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17885.19.997093137033517e-262splicesome-associated protein
(525 aa)
OxytrichaContig19116.0.1.g1024.000944328304913e-112hypothetical protein
WormBaseWBGene000117587.999011707514803e-86status:Confirmed UniProt:Q22
469 protein_id:CAA91420.2
DictyBaseDDB_G02700209.001321650308988e-69sf3a3 on chromosome: 1 positio
n 4032294 to 4034133
Stentor CoeruleusSteCoe_2685.665668176358939e-52
SGDYDL030W1.9993430003514377e-39PRP9 Subunit of the SF3a splic
ing factor complex, required f
or spliceosome assembly; acts
after the formation of the U1
snRNP-pre-mRNA complex

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00649280(coding)
ATGTCAGCGAATTGGTTAGAGTAAACAAGAAGTGTTTTAGAAAACATTGAACTTCTTGAT
CAGACTGTTTTGGATTTCATGTTTGATAAACTTGAAAATCCTAAAGATTAGGTGATCATT
GATAATAAATTAAAAAATTTGATTGAAATGAAGTAAAGTAAATGCATGGATGCTTTAATA
TTACTATAAGATTTTGATGGCGTTAAGAAAGAAGAAATGGCTATCCTTGAAGGCAAAAAG
AGTGTTAGTGCTGGTACAAGATAGCCTGATATTTGGTATAATTTCTAATAGCGCTTAAAG
GATATTAAGGAATATTATAAAAAGCATTAGAATCAAAATATTTAAGTAATCGATAAGGAA
TTCTTGAAAAAAAATGTATTCAGTCCTCCTTATTCTGAACCTTTATTTTCTACTGATGAA
TAATAAGGAAAATATGTTGATATGAATGTGCTTTATTATGAATTTTTAAGTTTTGATTTA
AAGAAAAAGAAAAAAGTTAGACTTTCTGAAGATTACCACATTGGTGATTATTTGTGGTAC
TTAGAAAAGTTTGATGCCTTCCACGAAATTCCTCTTGCTCTTAAATAAAAAGAATATTCA
AGTTATAAGTAATACTTATAGAACCTTATTAATTACTTGAAGGAATTCTTTTTAAAAACT
CAACCTTTGACTGAGTTTTCCATTATTGATAGATAAATTCAGTAGGACTTCGAATATCGC
TGGAAAGAAGGATCTATTCCAGGCTGGACAAATTCAGGATATGAAGATGTTATTGATTAT
TCAAGCAATGAACTTTTCTGCAAAGCATGTAAGAAGTTATTCTCCAACAGTAGTATTTTC
GCCCATCACTTAGAAGGTAAGAAACATAAAATGGCTCAAAAAAATCTTGAAAAAGAAGAA
GAAAAAATGTCTAAATTAGAAGGAGCTCCTGAAAAAACTGATATGGGATAGGATGATTAA
GATTAGTAAACTACAGGAGAAATTAACATGAAGGATGAGTAAAAGAAAAAATAATTAGCT
CATTTAGAATAATATATTATAGGCTTGAAAAAATAATTAGGTGAGGTAATTAATGAAACT
ATCCTCTATGTTAAAAAGAAGCAAACAAGAACATATTAAGAAATTGAAGCAGAAAACCAA
TAAGAAAAGGATGCTGAACCCTAGAGTGATAGTGAAGATGATGACATTCCATACAATCCT
AAGAATGTGCCTTTGGGCCCTGATGGAAAGCCTATTCCATATTGGTTGTACAAGCTTCAC
TAGCTAGGTATTGAGTACAAATGTGAAATATGTGGTAACTACAGTTACTGGGGAAGAAGA
GCTTTTGAAAAGCATTTCTCAGAATGGAGACACAGTTATGGTATGAAGTGCTTAAAAATA
CCCAATACTATTCACTTCAAGGAAATTACATCTATCAAGGATGCTCTCGCTCTTCACCAT
AAACTTTCTATGGAAAGCGAATATTCTTAATTCAACATTGATCAAGAAGAAGAATATGAA
GATTCTGATGGAAATATACTTAACAAAAAGACTTATAATGATCTTAAAAAGCAAGGATTG
TTGTGA


>TTHERM_00649280(protein)
MSANWLEQTRSVLENIELLDQTVLDFMFDKLENPKDQVIIDNKLKNLIEMKQSKCMDALI
LLQDFDGVKKEEMAILEGKKSVSAGTRQPDIWYNFQQRLKDIKEYYKKHQNQNIQVIDKE
FLKKNVFSPPYSEPLFSTDEQQGKYVDMNVLYYEFLSFDLKKKKKVRLSEDYHIGDYLWY
LEKFDAFHEIPLALKQKEYSSYKQYLQNLINYLKEFFLKTQPLTEFSIIDRQIQQDFEYR
WKEGSIPGWTNSGYEDVIDYSSNELFCKACKKLFSNSSIFAHHLEGKKHKMAQKNLEKEE
EKMSKLEGAPEKTDMGQDDQDQQTTGEINMKDEQKKKQLAHLEQYIIGLKKQLGEVINET
ILYVKKKQTRTYQEIEAENQQEKDAEPQSDSEDDDIPYNPKNVPLGPDGKPIPYWLYKLH
QLGIEYKCEICGNYSYWGRRAFEKHFSEWRHSYGMKCLKIPNTIHFKEITSIKDALALHH
KLSMESEYSQFNIDQEEEYEDSDGNILNKKTYNDLKKQGLL


>TTHERM_00649280(gene)
ATGTCAGCGAATTGGTTAGAGTAAACAAGAAGTGTTTTAGAAAACATTGAACTTCTTGAT
CAGACTGTTTTGGATTTCATGTTTGATAAACTTGAAAATCCTAAAGATTAGGTGATCATT
GATAATAAATTAAAAAATTTGATTGAAATGAAGTAAAGTAAATGCATGGATGCTTTAATA
TTACTATAAGATTTTGATGGCGTTAAGAAAGAAGAAATGGCTATCCTTGAAGGCAAAAAG
AGTGTTAGTGCTGGTACAAGATAGCCTGATATTTGGTATAATTTCTAATAGCGCTTAAAG
GATATTAAGGAATATTATAAAAAGCATTAGAATCAAAATATTTAAGTAATCGATAAGGAA
TTCTTGAAAAAAAATGTATTCAGTCCTCCTTATTCTGAACCTTTATTTTCTACTGATGAA
TAATAAGGAAAATATGTTGATATGAATGTGCTTTATTATGAATTTTTAAGTTTTGATTTA
AAGAAAAAGAAAAAAGTTAGACTTTCTGAAGATTACCACATTGGTGATTATTTGTGGTAC
TTAGAAAAGTTTGATGCCTTCCACGAAATTCCTCTTGCTCTTAAATAAAAAGAATATTCA
AGTTATAAGTAATACTTATAGAACCTTATTAATTACTTGAAGGAATTCTTTTTAAAAACT
CAACCTTTGACTGAGTTTTCCATTATTGATAGATAAATTCAGTAGGACTTCGAATATCGC
TGGAAAGAAGGATCTATTCCAGGCTGGACAAATTCAGGATATGAAGATGTTATTGATTAT
TCAAGCAATGAACTTTTCTGCAAAGCATGTAAGAAGTTATTCTCCAACAGTAGTATTTTC
GCCCATCACTTAGAAGGTAAGAAACATAAAATGGCTCAAAAAAATCTTGAAAAAGAAGAA
GAAAAAATGTCTAAATTAGAAGGAGCTCCTGAAAAAACTGATATGGGATAGGATGATTAA
GATTAGTAAACTACAGGAGAAATTAACATGAAGGATGAGTAAAAGAAAAAATAATTAGCT
CATTTAGAATAATATATTATAGGCTTGAAAAAATAATTAGGTGAGGTAATTAATGAAACT
ATCCTCTATGTTAAAAAGAAGCAAACAAGGTAAAGATCATTTATTTTAATTAAAAGATGT
ATTTTAAATTTATTTTTAAAAAAGAACATATTAAGAAATTGAAGCAGAAAACCAATAAGA
AAAGGATGCTGAACCCTAGAGTGATAGTGAAGATGATGACATTCCATACAATCCTAAGAA
TGTGCCTTTGGGCCCTGATGGAAAGCCTATTCCATATTGGTTGTACAAGCTTCACTAGCT
AGGTATTGAGTACAAATGTGAAATATGTGGTAACTACAGTTACTGGGGAAGAAGAGCTTT
TGAAAAGCATTTCTCAGAATGGAGACACAGTTATGGTATGAAGTGCTTAAAAATACCCAA
TACTATTCACTTCAAGGAAATTACATCTATCAAGGATGCTCTCGCTCTTCACCATAAACT
TTCTATGGAAAGCGAATATTCTTAATTCAACATTGATCAAGAAGAAGAATATGAAGATTC
TGATGGAAATATACTTAACAAAAAGACTTATAATGATCTTAAAAAGCAAGGATTGTTGTG
A