Identifiers and Description

Gene Model Identifier

TTHERM_00079300

Standard Name

PRP8 (Pre-mRNA Processing)

Aliases

PreTt10176 | 5.m00527 | 3828.m01438

Description

PRP8 Pre-mRNA-processing-splicing factor 8; Mov34/MPN/PAD-1 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF08083 ) PROCN (NUC071) domain
  • ( PF08084 ) PROCT (NUC072) domain
  • ( PF01398 ) Mov34/MPN/PAD-1 family
  • ( PF08082 ) PRO8NT (NUC069) domain
  • ( PF04673 ) Polyketide synthesis cyclase
  • ( PF03002 ) Somatostatin/Cortistatin family
  • ( TIGR00072 ) hydrogenase maturation protease
  • ( TIGR00864 ) polycystin cation channel protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00079300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_357850
WormBaseWBGene000041879.997093137033517e-262locus:prp-8 Pre-mRNA-splicin
g factor 8 homolog status:Pa
rtially_confirmed UniProt:P3
4369 protein_id:CCD66122.1
Tetrahymena borealisEI9_07011.19.997093137033517e-262hypothetical protein (2350 aa)
DictyBaseDDB_G02742299.997093137033517e-262prpf8 on chromosome: 2 positio
n 4703192 to 4710497
OxytrichaContig21646.0.1.g1039.997093137033517e-262hypothetical protein
SGDYHR165C9.997093137033517e-262PRP8 Component of the U4/U6-U5
snRNP complex, involved in th
e second catalytic step of spl
icing; mutations of human Prp8
cause retinitis pigmentosa

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00079300(coding)
ATGCAAGGATATCCTCATATGCCTCCTGGTGGTATGATTCCACCTCATTAAAATATGATG
CCAAAAATGGGCATGATGCCTCCACCTCATCATTAAATGCAACAGCCTCCTATGATGCAT
GAATAGTATTTAGATGATAAAATTAAAAAATGGCGTCAAATGAATTCTAAAAAGTATGAA
GAAAAGCGTAAATTTGATAACAGCGGTATTTAAAAAGAGAAAATGCCTCCAGAAGTAATA
AGAAAAATTATAAAAGATCATGGTGATATGAGTTCTAAGAAATTTAGATAGGACAAAAGA
GTTTATTTGGGTGCTTTGAAATATATTCCTCATGCTGTGTATAAACTATTAGAAAATATG
CCTTAGCCTTGGGAATAGGTAAGAGAAGTAAAGGTATTGTATCATACAACTGGTGCCATT
ACTTTTGCCAATGAAATTCCTTTTGTTATTGAACCAGTTTATTTAGCTTAATGGGGAACT
ATGTGGATTATGATGAGAAAGGAAAAGAAAGACAGAAAACACTTCAAAAGAATGAGATTC
CCTCCTTTTGATGATGAAGAACCTCCTTTGGATTATGGTGATAACGTTTTATCAGTAGAA
CCTTCTGAATCTATTTAAATGGAATTAGACGAAGTTGATGATAACCCAGTTTTCGATTGG
TTCTATGATCATAGACCACTCTAATTCTCTAAAAATGTAAATGGTTTATCTTATAAAAAA
TGGCACTTACCTCTTGAAGTTATGTCAAATTTATACAGACTAGCCAATTAGTTAATGAGT
GACATTGTAGATAAAAATTATTTCTATTTGTTTGATCTGAAATCTTTCTACACTGCCAAG
GCTCTTAATATGGCCATCCCTGGTGGTCCTAAATTTGAACCTTTGTACAGAGATTTGGAG
GAAGATGATGACTGGAATGAATTTAATGATATTAACAAGATTATTATTAGACAATAAATT
CGTACAGAATATAAAATTGCTTTCCCTTTCCTATATAATTCTCGTCCTCGTCGTGTTGCT
ATTGCACCTTATCACTATCCTGCTTGTTGCTATATTAAGTAAGAAAATCCTGATTTACCT
GCCTTCTATTTCGATGAAATTATCAATCCTATTGTTGATAAGAATAGAAGAACAACCAGA
GTTGAAATTGAATTTTCTCAAGATGAGTTAAATTTAGATGAAATTGTTATGTCCGAAGAT
TTTGAACCCTTCTTGTATGATGAACCTCTTTATGATTCTTAGACTAGTGATGGTATCAGT
CTTTTGTGGGCTCCTAAGCCATTTAATTAACGTACAGGTAAAAATCGTCGTTCTTTTGAT
ATTCCTCTTGTTTCTAACTGGTTCAAGGAGCGTTGTAACCCTGAAAACCCTGTTAAGGTT
CGTGTTTCTTACTAGAAGCTTCTTAAATGTTGGGTACTCAATTCTTTACATAAGCGTAAA
CCCAAAGCTTAGTGCAAAAAATCTTTATTTAAAGCTTTTGCTTCTACAAAATTCTTCTAA
TATACTGAACTTGATTGGGTAGAAATTGGTTTATAGGTTTGTAGATAAGGTTATAATATG
TTAAATTTATTGATCCATCGTAAGAATTTAAATTACTTGCATTTAGATTACAACTTTAAC
TTGAAGCCTGTAAAGACATTAACAACTAAAGAAAGAAAGAAATCTCGTTTCGGTAATGCA
TTCCATTTGTGTAGAGAAATTCTTCGTTTAGTAAAGCTAGTTGTTGACTCTCACGTTTAA
TATCGTTAGGGTAATGTTGATGCATTTTAATTAGCTGATGGTTTACAATATGTTTTCTCT
CATGTTGGTTAATTAACTGGTATGTATCGTTACAAATATCGTCTTATGCGTTAAATTCGT
ATGTGCAAGGATCTTAAGCATCTTATCTATTATCGTTTTAACACAGGTCCAGTTGGTAAA
GGTCCAGGTTGTGGTTTCTGGGCTCCTATGTGGCGTGTGTGGCTTTTCTTCATGAGAGGT
ATTATTCCACTATTAGAACGTTGGCTTGGTAATTTACTAGCCCGTTAATTCGAAGGTCGT
CACTCAAAGGGTGCTTCTAAATCTGTCACCAAGCAACGTGATGAATCAAACTTTGATCTT
GAATTACGTTCTGCAGTCATGATGAGTATTAGTGATATGATGCCTGAAGGAGTTAAGGCT
AATAAGAATCGTACTATTATGCAACATCTCAGTGAAGCTTGGCGTTGTTGGAAGGCCAAT
ATACCCTGGAAGGTCCCAGGTATGCCTGCTCCTATTGAAAATATTATTCTTCGTTTTGTG
AAGCAAAAAGCTGATTGGTGGACTAATGCAGCCTACTATAATCGTGAAAGAATTCGTCGT
GGTGCTACTGTCGATAAGACTGTATGCAAAAAAAATATGGGTCGTCTTACTCGTTTGTTC
TTAAAGAATGAATAAGAAAGGTAACATAACTATTTGAAGGATGGTCCTTATTTACAACCA
GATGAAGCTGTTTCTATTTACACAATGTTAGTCCATTGGCTTGAATCAAGAAAGTTCAGT
CATATTCCTTTCCCACCTATTAATTATAAACACGATACAAAACTCTTCATTTTAGCCTTA
GAGCGTCTAAAGGAAGCTTACTCAGTTAAAAGTAGACTCAATTAAAGTTAAAGAGAAGAA
CTTGCATTGATTGAACAAGCTTATGATAATCCTCATGAAGCTCTTACTCGTGTTAAGCGT
TAACTCTTGACACAAAGACAATTCAAAGATGTCTCTATAGAATTTATGGATCTCTACTCT
CACTTAGTACCAGTCTATGATGTTGATCCTATGGAAAAAATCACTGATGCCTATCTTGAC
TAGTATCTCTGGTATGAAGCTGATAAGCGTCGTCTCTTCCCTAACTGGATCAAACCAGCT
GACTCTGAACCCCCACCATTACTTGTTTACAAGTGGTGCCAAGGTATAAACAACTTATAA
GGTATTTGGGATACCTCCGAAGGATAAAGCATTGTGCTTCTTGAGTCTAGATTTGAAAAG
GTCTATGAAAAAATAGACTTGACCTTCTTAAATAGACTTTTAAGATTGATTGTTGATCAC
AATATAGCTGATTATATGACAGCTAAAAATAATGTGGTCATTAATTTCAAAGATATGAAC
CATACAAATAGTTATGGTATTAATCACGGTCTTTAGTTCACTTCTTTCCTCTATTAGTTC
TATGGATTAATTCTCGATCTTCTTATCCTTGGTCTATAGCGTGCAAGTGAACTTTCAGGT
CCTCCTAACTAGCCAAATGATTTTATGACTTTCTCAGATATTAAAACAGAAGTAAGTCAC
CCTATAAGACTCTATTGCAGATACATTGATCGTTTCTATATGGTATTCCGCTTCGATGAA
GATTAAAGCAGAGAATTAGTTCAGCGTTATTTAACAGAAAATCCTGATCCAAATAATGAA
AATATAGTAGGATATAACAATAAAAAATGTTGGCCTAAGGATTGCCGTATGCGTTTGATG
AAGCACGATGTCAATCTAGGACGTGCAGTCTTTTGGGAAATGAAAAATAGACTTCCCCGT
TGTTTGACTACTATGGAGTGGGAACATTCATTCTGTTCTGTGTATTCAAAGGACAATCCA
AATCTACTATTCAATATGTGTGGATTCGAAGTACGTATTCTTCCAAAATTACGTTCCTTG
AACGAAAGTTTCACTTAGAGAGATGGTGTTTGGAAATTATAAAACGAAACTACTAAAGAA
ATTACAGCCTAAGCTTTCTTGCGTGTTGATGAAGAATCTATGAAGAGATTTGAAAACAGA
GTTCGTTAAATTTTGATGGCTTCTGGTAGTACTACATTCACTAAAATTGCTAACAAATGG
AATACATCCCTGATTGGTTTGATGACTTATTTCCGTGAAGCAGTTATTCACACTGAGTAG
ATGCTCGATTTACTTGTAAAGTGTGAAAACAAGATTCAAACTCGTATCAAAATTGGTCTC
AATTCTAAAATGCCCAGTCGTTTCCCACCTGTCGTTTTCTATACACCTAAAGAACTTGGT
GGTTTAGGTATGTTGTCTATGGGTCACATTTTGATTCCTTAGAGTGATTTAAGATTCTTT
AAGCAAACAGACTCAGGTATTTCTCACTTCCGTGCTGGTATGAGTCATGAAGAAGACTAG
CTTATTCCTAACTTGCACAGATACATTTAATCATGGGAATCAGAATTTTTGGATTCTCAA
AGAGTTTGGGCTGAATATGCTCTCAAAAAGTAAGAAGCTCTCTCTTAGAATAGAAGACTA
ACTATTGATGAGCTTATGGAAAGTTGGGACCATGGTATTCCACGTATCAACACACTTTTC
TAGAAAGACAGATTGACTTTAGCATACGATAAAGGTTGGAGAGTTCGTTAAGACTTCAAA
TAATATCAAATTTTGAAATAAAATCCTTTCTGGTGGACACACAATCGTCACGACGGTAAA
TTGTGGAATTTGAATCACTATCGTACTGATATGATTTAAGCTCTTGGTGGTGTTGAAGGT
ATTTTAGAACACACTTTATTCAAAGGTACTTATTTCACTACTTGGGAAGGTCTGTTTTGG
GAAAAAGCTTCAGGTTTCGAAGAATCTATGAAATATAAAAAATTGACACATGCCTAACGT
AGTGGTTTAAATCAAATTCCTAATAGACGTTTCACTTTATGGTGGTCCCCAACAATTAAC
AGAGCTAATGTCTATATTGGTTTCTAGGTACAGCTTGATTTGACTGGTATTTTTATGCAT
GGTAAGATTCCTACTCTTAAGATTTCTCTTATTTAGATCTTCCGTGCTCACTTGTGGCAA
AAGATTCATGAGTCTGTCGTTATGGATCTCTGTTAAGTTTTTGATATGGAATTAGACTCA
TTAAATATTGAAACAACCCAAAAAGAAACAATCCACCCTCGTAAGTCTTATAAGATGAAT
TCATCTTGTGCTGATATACTACTATATGCAGCCTTCAAGTGGCCTGTTAGTAAACCATCT
CTTCTCCACGAGCAAAAGGATTCTTATGATGGTACTACTACTAATAAATATTGGCTTGAT
GTCCAACTTCGTTGGGGTGATTATGACTCTCACGATATTGAACGTTATGCTCGTGCTAAA
TTCTTAGATTATACAAATGATAATATTTCTATATATCCTTCACCTCATGGTTGCTTGATA
GCTATTGATTTGGCTTATAACCTTCATTCTGCTTACGGTACTTGGTTTGAAGGTGGCAAG
ACCCTTATCCTTTAAGCTATGAATAAGATCATGAAATGCAATCCAGCTCTTTATGTATTA
CGTGAAAGAATTCGTAAAGGTCTTTAACTCTATTCATCTGAACCCACTGAACCTTATCTT
TCTAGTTCTAATTTCTCAGAACTCTTCTCCAACTAAACTATTTGGTTCGTTGATGATACC
AATGTCTATCGTGTCACTATCCACAAGACTCAAGAAGGTAACTTAACAACCAAGCCTACA
AATGGTGCTATCTTTATTTTCAATCCTCGTACTGGTGAACTCTTCTTGAAGATTATTCAC
ACTTCAGTCTGGGCTGGTCAAAAGCGTCTTGGTTAATTAGCAAAGTGGAAAACTGCTGAA
GAAGTTGCAGCTCTTATTCGTGCTCTTCCAGTAGAAGAATAACCCAGATAAATTATTGTT
ACAAGAAAGGGTATGCTTGATCCTATGGAAGTTCACTTACTTGATTTCCCTAACATTGTC
ATTAAGGGTTCAGAAATGTAGCTTCCTTTCTAATCTTGCTTAAAAGTAGAAAAGCTTGGT
GATTTGATTTTGAAGGCAACTGAACCTTAGATGGTTGTCTTTAATTTATATGACAATTGG
ATGTCAAGTTGCTCATCAAACACAGCTTTCTCAAGACTAATTTTAGTCCTCCGTGCTCTT
CACGTCAATATTGATAAAGCTCGTATGATTCTTAAACCCAACAAGTAAGTTATCACATAA
CCTAATCATATTTGGCCTACATTAACTGATGATGAATGGGTAAAGGTAGAAAATGAATTG
AAAAATTTAATTTTGGCTGATTACTGCAAGAAAAATAATGTCAACATTTAAGCATTGACT
TAATTAGAAATTAGAGATATCATTCTAGGTCAAGAAATGGCTCCTCCCTCAATGAAGGAC
GAACAAATTAAAGAAGTTGAAAAGTAATACAAGGAAGCTCAGCACTAGTAGGAAACTACA
GTTAAAACTACAAATGTTCTTGGAGAAGAAATTACAGTTACAGTATAAAAGCCATACGAA
TAGTAACAATTTAGATCTCATACCAACTGGAAGACTCGTGCTATTTCTGCTACTAACCTT
CACTTGCGTGCTAAACATATCTATGTCACTAAAGTAGACATTGAAGAATCTGGATACACA
TACATGTTCCCTAAAAATATACTAAAGAAATTTATTTCTATTGCTGATTTGCAGACTCAA
ATCGGTGGTTTCATGTTTGGTGTTTCACCTCCATAAAATTCATAAATTAAGGAAGTACGT
TGTATAGTAATGGTACCTCAAACTGGTAATAAAGAAAGTGTAACTTTCTGTCCTTCTTTA
CCTGAAGGTGGATATCTTAAAAATCTAGAACCTCTAGGTTGGATACATACTCAATCTGAA
GAAAAAATGCAGCTATCACCTTATGATACAAATCTACATAGTAAATTCTTAGCTGAAAAC
TAGTCTTGGAATCCTGAAGTATCCATAACATTGACTGTTTCTTTCACACCAGGTTCTTGC
TCTCTCACTGGATATAAACTTACAAAGGCAGGTTATGAATGGGGTAAGAAGAACAAAGAC
TTGCAAGCAACTCAAGGATTTACTAATACTCACTATGAAAAAGTATAGCTTTTCCTTTCT
GATAAGATTAGAGGATTCTTTATGGTTCCAGATAACCACATTTGGAACTATTATTCCATC
GGATTGGGTGTTGTGCAAAATGCAAGTTATGCTTTGACTCTTTCCAACCCTAAAGATTTC
TATCATGAAATTCACAGAGTTAGAGATTTCATCAAGTTTAATAAAGCTGCAGATGATGAA
AACTAAGACTTAGTTGACAATGAAGATCTTTTTGAATGA


>TTHERM_00079300(protein)
MQGYPHMPPGGMIPPHQNMMPKMGMMPPPHHQMQQPPMMHEQYLDDKIKKWRQMNSKKYE
EKRKFDNSGIQKEKMPPEVIRKIIKDHGDMSSKKFRQDKRVYLGALKYIPHAVYKLLENM
PQPWEQVREVKVLYHTTGAITFANEIPFVIEPVYLAQWGTMWIMMRKEKKDRKHFKRMRF
PPFDDEEPPLDYGDNVLSVEPSESIQMELDEVDDNPVFDWFYDHRPLQFSKNVNGLSYKK
WHLPLEVMSNLYRLANQLMSDIVDKNYFYLFDLKSFYTAKALNMAIPGGPKFEPLYRDLE
EDDDWNEFNDINKIIIRQQIRTEYKIAFPFLYNSRPRRVAIAPYHYPACCYIKQENPDLP
AFYFDEIINPIVDKNRRTTRVEIEFSQDELNLDEIVMSEDFEPFLYDEPLYDSQTSDGIS
LLWAPKPFNQRTGKNRRSFDIPLVSNWFKERCNPENPVKVRVSYQKLLKCWVLNSLHKRK
PKAQCKKSLFKAFASTKFFQYTELDWVEIGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFN
LKPVKTLTTKERKKSRFGNAFHLCREILRLVKLVVDSHVQYRQGNVDAFQLADGLQYVFS
HVGQLTGMYRYKYRLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAPMWRVWLFFMRG
IIPLLERWLGNLLARQFEGRHSKGASKSVTKQRDESNFDLELRSAVMMSISDMMPEGVKA
NKNRTIMQHLSEAWRCWKANIPWKVPGMPAPIENIILRFVKQKADWWTNAAYYNRERIRR
GATVDKTVCKKNMGRLTRLFLKNEQERQHNYLKDGPYLQPDEAVSIYTMLVHWLESRKFS
HIPFPPINYKHDTKLFILALERLKEAYSVKSRLNQSQREELALIEQAYDNPHEALTRVKR
QLLTQRQFKDVSIEFMDLYSHLVPVYDVDPMEKITDAYLDQYLWYEADKRRLFPNWIKPA
DSEPPPLLVYKWCQGINNLQGIWDTSEGQSIVLLESRFEKVYEKIDLTFLNRLLRLIVDH
NIADYMTAKNNVVINFKDMNHTNSYGINHGLQFTSFLYQFYGLILDLLILGLQRASELSG
PPNQPNDFMTFSDIKTEVSHPIRLYCRYIDRFYMVFRFDEDQSRELVQRYLTENPDPNNE
NIVGYNNKKCWPKDCRMRLMKHDVNLGRAVFWEMKNRLPRCLTTMEWEHSFCSVYSKDNP
NLLFNMCGFEVRILPKLRSLNESFTQRDGVWKLQNETTKEITAQAFLRVDEESMKRFENR
VRQILMASGSTTFTKIANKWNTSLIGLMTYFREAVIHTEQMLDLLVKCENKIQTRIKIGL
NSKMPSRFPPVVFYTPKELGGLGMLSMGHILIPQSDLRFFKQTDSGISHFRAGMSHEEDQ
LIPNLHRYIQSWESEFLDSQRVWAEYALKKQEALSQNRRLTIDELMESWDHGIPRINTLF
QKDRLTLAYDKGWRVRQDFKQYQILKQNPFWWTHNRHDGKLWNLNHYRTDMIQALGGVEG
ILEHTLFKGTYFTTWEGLFWEKASGFEESMKYKKLTHAQRSGLNQIPNRRFTLWWSPTIN
RANVYIGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVFDMELDS
LNIETTQKETIHPRKSYKMNSSCADILLYAAFKWPVSKPSLLHEQKDSYDGTTTNKYWLD
VQLRWGDYDSHDIERYARAKFLDYTNDNISIYPSPHGCLIAIDLAYNLHSAYGTWFEGGK
TLILQAMNKIMKCNPALYVLRERIRKGLQLYSSEPTEPYLSSSNFSELFSNQTIWFVDDT
NVYRVTIHKTQEGNLTTKPTNGAIFIFNPRTGELFLKIIHTSVWAGQKRLGQLAKWKTAE
EVAALIRALPVEEQPRQIIVTRKGMLDPMEVHLLDFPNIVIKGSEMQLPFQSCLKVEKLG
DLILKATEPQMVVFNLYDNWMSSCSSNTAFSRLILVLRALHVNIDKARMILKPNKQVITQ
PNHIWPTLTDDEWVKVENELKNLILADYCKKNNVNIQALTQLEIRDIILGQEMAPPSMKD
EQIKEVEKQYKEAQHQQETTVKTTNVLGEEITVTVQKPYEQQQFRSHTNWKTRAISATNL
HLRAKHIYVTKVDIEESGYTYMFPKNILKKFISIADLQTQIGGFMFGVSPPQNSQIKEVR
CIVMVPQTGNKESVTFCPSLPEGGYLKNLEPLGWIHTQSEEKMQLSPYDTNLHSKFLAEN
QSWNPEVSITLTVSFTPGSCSLTGYKLTKAGYEWGKKNKDLQATQGFTNTHYEKVQLFLS
DKIRGFFMVPDNHIWNYYSIGLGVVQNASYALTLSNPKDFYHEIHRVRDFIKFNKAADDE
NQDLVDNEDLFE


>TTHERM_00079300(gene)
ATGCAAGGTAGATTTAATTATTTTCAAATTGATTAGGATATAAAAATGAAATTTAAATGA
AAACATAAAAATACGTTCATTATATTATTAAGATTTAGGGAATAGTCAATAAAATTCTAT
TTTATAAAATATATTTATAGGATATCCTCATATGCCTCCTGGTGGTATGATTCCACCTCA
TTAAAATATGATGCCAAAAATGGGCATGATGCCTCCACCTCATCATTAAATGCAACAGCC
TCCTATGATGCATGAATAGTATTTAGATGATAAAATTAAAAAATGGCGTCAAATGAATTC
TAAAAAGTATGAAGAAAAGCGTAAATTTGATAACAGCGGTATTTAAAAAGAGAAAATGCC
TCCAGAAGTAATAAGGTAAATTTGAAAAATCGAAATTTATAAATTTTTATAATATAATTG
TTCAGTATTTGTTAAATTATATTAACTCTTAAAACCTGACATATATTACATATTGTTTAT
TTTATTCAATTAGAAAAATTATAAAAGATCATGGTGATATGAGTTCTAAGAAATTTAGAT
AGGACAAAAGAGTTTATTTGGGTGCTTTGAAATATATTCCTCATGCTGTGTATAAACTAT
TAGAAAATATGCCTTAGCCTTGGGAATAGGTAAATAAATTTATTTTAAGTATTAAAGCAT
CAAACAAAGTGAGCAAGTTATTCAAAATACTAATAAGATTTTTAGATATTTGCTATTTAT
AAGCACAAATAAGGAATCATTAAAGTAAATAAATATATTGCAAAAAAGGATGTTAGTAGA
TCTAAAATATAAAAAGATAAAACAATTTCAAGTTCTAAATGTAATTATTTAAAAAGATAC
AATAAAAACTGCTAAATACAAAAAAGTTAATCAATCTATACAAGTTAATAAAATACATAT
TTAAAAAATATATTTTATGAATAAATATAATATTGAATTTTAAAAATTAGTAGTAAATAA
AGAAAAAATCACCACTTATCAAAATTTAATAAAAAGACAAAATAAATAACTAAAAATTAA
GTTAAAATTTTTAAATTAGCAAAAATAAAAATGATTTTAGAAAAATAAATAATAATAATA
TAATATGTTTGAATAAATAAATAAATGAATTAATTAATTATTAATTATTTAATAGGTAAG
AGAAGTAAAGGTATTGTATCATACAACTGGTGCCATTACTTTTGCCAATGAAATTCCTTT
TGTTATTGAACCAGTTTATTTAGCTTAATGGGGAACTATGTGGATTATGATGAGAAAGGA
AAAGAAAGACAGAAAACACTTCAAAAGAATGAGATTCCCTCCTTTTGATGATGAAGAACC
TCCTTTGGATTATGGTGATAACGTTTTATCAGTAGAACCTTCTGAATCTATTTAAATGGA
ATTAGACGAAGTTGATGATAACCCAGTTTTCGATTGGTTCTATGATCATAGACCACTCTA
ATTCTCTAAAAATGTAAATGGTTTATCTTATAAAAAATGGCACTTACCTCTTGAAGTTAT
GTCAAATTTATACAGACTAGCCAATTAGTTAATGAGTGACATTGTAGATAAAAATTATTT
CTATTTGTTTGATCTGAAATCTTTCTACACTGCCAAGGCTCTTAATATGGCCATCCCTGG
TGGTCCTAAATTTGAACCTTTGTACAGAGATTTGGAGGAAGATGATGACTGGAATGAATT
TAATGATATTAACAAGATTATTATTAGACAATAAATTCGTACAGAATATAAAATTGCTTT
CCCTTTCCTATATAATTCTCGTCCTCGTCGTGTTGCTATTGCACCTTATCACTATCCTGC
TTGTTGCTATATTAAGTAAGAAAATCCTGATTTACCTGCCTTCTATTTCGATGAAATTAT
CAATCCTATTGTTGATAAGAATAGAAGAACAACCAGAGTTGAAATTGAATTTTCTCAAGA
TGAGTTAAATTTAGATGAAATTGTTATGTCCGAAGATTTTGAACCCTTCTTGTATGATGA
ACCTCTTTATGATTCTTAGACTAGTGATGGTATCAGTCTTTTGTGGGCTCCTAAGCCATT
TAATTAACGTACAGGTAAAAATCGTCGTTCTTTTGATATTCCTCTTGTTTCTAACTGGTT
CAAGGAGCGTTGTAACCCTGAAAACCCTGTTAAGGTTCGTGTTTCTTACTAGAAGCTTCT
TAAATGTTGGGTACTCAATTCTTTACATAAGCGTAAACCCAAAGCTTAGTGCAAAAAATC
TTTATTTAAAGCTTTTGCTTCTACAAAATTCTTCTAATATACTGAACTTGATTGGGTAGA
AATTGGTTTATAGGTTTGTAGATAAGGTTATAATATGTTAAATTTATTGATCCATCGTAA
GAATTTAAATTACTTGCATTTAGATTACAACTTTAACTTGAAGCCTGTAAAGACATTAAC
AACTAAAGAAAGAAAGAAATCTCGTTTCGGTAATGCATTCCATTTGTGTAGAGAAATTCT
TCGTTTAGTAAAGCTAGTTGTTGACTCTCACGTTTAATATCGTTAGGGTAATGTTGATGC
ATTTTAATTAGCTGATGGTTTACAATATGTTTTCTCTCATGTTGGTTAATTAACTGGTAT
GTATCGTTACAAATATCGTCTTATGCGTTAAATTCGTATGTGCAAGGATCTTAAGCATCT
TATCTATTATCGTTTTAACACAGGTCCAGTTGGTAAAGGTCCAGGTTGTGGTTTCTGGGC
TCCTATGTGGCGTGTGTGGCTTTTCTTCATGAGAGGTATTATTCCACTATTAGAACGTTG
GCTTGGTAATTTACTAGCCCGTTAATTCGAAGGTCGTCACTCAAAGGGTGCTTCTAAATC
TGTCACCAAGCAACGTGATGAATCAAACTTTGATCTTGAATTACGTTCTGCAGTCATGAT
GAGTATTAGTGATATGATGCCTGAAGGAGTTAAGGCTAATAAGAATCGTACTATTATGCA
ACATCTCAGTGAAGCTTGGCGTTGTTGGAAGGCCAATATACCCTGGAAGGTCCCAGGTAT
GCCTGCTCCTATTGAAAATATTATTCTTCGTTTTGTGAAGCAAAAAGCTGATTGGTGGAC
TAATGCAGCCTACTATAATCGTGAAAGAATTCGTCGTGGTGCTACTGTCGATAAGACTGT
ATGCAAAAAAAATATGGGTCGTCTTACTCGTTTGTTCTTAAAGAATGAATAAGAAAGGTA
ACATAACTATTTGAAGGATGGTCCTTATTTACAACCAGATGAAGCTGTTTCTATTTACAC
AATGTTAGTCCATTGGCTTGAATCAAGAAAGTTCAGTCATATTCCTTTCCCACCTATTAA
TTATAAACACGATACAAAACTCTTCATTTTAGCCTTAGAGCGTCTAAAGGAAGCTTACTC
AGTTAAAAGTAGACTCAATTAAAGTTAAAGAGAAGAACTTGCATTGATTGAACAAGCTTA
TGATAATCCTCATGAAGCTCTTACTCGTGTTAAGCGTTAACTCTTGACACAAAGACAATT
CAAAGATGTCTCTATAGAATTTATGGATCTCTACTCTCACTTAGTACCAGTCTATGATGT
TGATCCTATGGAAAAAATCACTGATGCCTATCTTGACTAGTATCTCTGGTATGAAGCTGA
TAAGCGTCGTCTCTTCCCTAACTGGATCAAACCAGCTGACTCTGAAGTAATTTATAAAAA
TTAATCATAATTTTATTTTTATTCTAATCATATTATTAATACAAATAATAGCCCCCACCA
TTACTTGTTTACAAGTGGTGCCAAGGTATAAACAACTTATAAGGTATTTGGGATACCTCC
GAAGGATAAAGCATTGTGCTTCTTGAGTCTAGATTTGAAAAGGTCTATGAAAAAATAGAC
TTGACCTTCTTAAATAGACTTTTAAGATTGATTGTTGATCACAATATAGCTGATTATATG
ACAGCTAAAAATAATGTGGTCATTAATTTCAAAGATATGAACCATACAAATAGTTATGGT
ATTAATCACGGTCTTTAGTTCACTTCTTTCCTCTATTAGTTCTATGGATTAATTCTCGAT
CTTCTTATCCTTGGTCTATAGCGTGCAAGTGAACTTTCAGGTCCTCCTAACTAGCCAAAT
GATTTTATGACTTTCTCAGATATTAAAACAGAAGTAAGTCACCCTATAAGACTCTATTGC
AGATACATTGATCGTTTCTATATGGTATTCCGCTTCGATGAAGATTAAAGCAGAGAATTA
GTTCAGCGTTATTTAACAGAAAATCCTGATCCAAATAATGAAAATATAGTAGGATATAAC
AATAAAAAATGTTGGCCTAAGGATTGCCGTATGCGTTTGATGAAGCACGATGTCAATCTA
GGACGTGCAGTCTTTTGGGAAATGAAAAATAGACTTCCCCGTTGTTTGACTACTATGGAG
TGGGAACATTCATTCTGTTCTGTGTATTCAAAGGACAATCCAAATCTACTATTCAATATG
TGTGGATTCGAAGTACGTATTCTTCCAAAATTACGTTCCTTGAACGAAAGTTTCACTTAG
AGAGATGGTGTTTGGAAATTATAAAACGAAACTACTAAAGAAATTACAGCCTAAGCTTTC
TTGCGTGTTGATGAAGAATCTATGAAGAGATTTGAAAACAGAGTTCGTTAAATTTTGATG
GCTTCTGGTAGTACTACATTCACTAAAATTGCTAACAAATGGAATACATCCCTGATTGGT
TTGATGACTTATTTCCGTGAAGCAGTTATTCACACTGAGTAGATGCTCGATTTACTTGTA
AAGTGTGAAAACAAGATTCAAACTCGTATCAAAATTGGTCTCAATTCTAAAATGCCCAGT
CGTTTCCCACCTGTCGTTTTCTATACACCTAAAGAACTTGGTGGTTTAGGTAAAAAATTA
ATTTAAATTCAAATAAAAATTTTTACTATTTCATTAAAAACATTTTTATTTTATTTTATT
TTAATAACCTGCTTTAATTTTGAATTAAATTTATTTTTTATTTGTTTTTTAGGTATGTTG
TCTATGGGTCACATTTTGATTCCTTAGAGTGATTTAAGATTCTTTAAGCAAACAGACTCA
GGTATTTCTCACTTCCGTGCTGGTATGAGTCATGAAGAAGACTAGCTTATTCCTAACTTG
CACAGATACATTTAATCATGGGAATCAGAATTTTTGGATTCTCAAAGAGTTTGGGCTGAA
TATGCTCTCAAAAAGTAAGAAGCTCTCTCTTAGAATAGAAGACTAACTATTGATGAGCTT
ATGGAAAGTTGGGACCATGGTATTCCACGTATCAACACACTTTTCTAGAAAGACAGATTG
ACTTTAGCATACGATAAAGGTTGGAGAGTTCGTTAAGACTTCAAATAATATCAAATTTTG
AAATAAAATCCTTTCTGGTGGACACACAATCGTCACGACGGTAAATTGTGGAATTTGAAT
CACTATCGTACTGATATGATTTAAGCTCTTGGTGGTGTTGAAGGTATTTTAGAACACACT
TTATTCAAAGGTACTTATTTCACTACTTGGGAAGGTCTGTTTTGGGAAAAAGCTTCAGGT
TTCGAAGAATCTATGAAATATAAAAAATTGACACATGCCTAACGTAGTGGTTTAAATCAA
ATTCCTAATAGACGTTTCACTTTATGGTGGTCCCCAACAATTAACAGAGCTAATGTCTAT
ATTGGTTTCTAGGTACAGCTTGATTTGACTGGTATTTTTATGCATGGTAAGATTCCTACT
CTTAAGATTTCTCTTATTTAGATCTTCCGTGCTCACTTGTGGCAAAAGATTCATGAGTCT
GTCGTTATGGATCTCTGTTAAGTTTTTGATATGGAATTAGACTCATTAAATATTGAAACA
ACCCAAAAAGAAACAATCCACCCTCGTAAGTCTTATAAGATGAATTCATCTTGTGCTGAT
ATACTACTATATGCAGCCTTCAAGTGGCCTGTTAGTAAACCATCTCTTCTCCACGAGCAA
AAGGATTCTTATGATGGTACTACTACTAATAAATATTGGCTTGATGTCCAACTTCGTTGG
GGTGATTATGACTCTCACGATATTGAACGTTATGCTCGTGCTAAATTCTTAGATTATACA
AATGATAATATTTCTATATATCCTTCACCTCATGGTTGCTTGATAGCTATTGATTTGGCT
TATAACCTTCATTCTGCTTACGGTACTTGGTTTGAAGGTGGCAAGACCCTTATCCTTTAA
GCTATGAATAAGATCATGAAATGCAATCCAGCTCTTTATGTATTACGTGAAAGAATTCGT
AAAGGTCTTTAACTCTATTCATCTGAACCCACTGAACCTTATCTTTCTAGTTCTAATTTC
TCAGAACTCTTCTCCAACTAAACTATTTGGTTCGTTGATGATACCAATGTCTATCGTGTC
ACTATCCACAAGACTCAAGAAGGTAACTTAACAACCAAGCCTACAAATGGTGCTATCTTT
ATTTTCAATCCTCGTACTGGTGAACTCTTCTTGAAGATTATTCACACTTCAGTCTGGGCT
GGTCAAAAGCGTCTTGGTTAATTAGCAAAGTGGAAAACTGCTGAAGAAGTAATAATTTTT
TTTCTTTTGTTTAAAATTAAATTAATTTTTTTAATCTTTAACAGGTTGCAGCTCTTATTC
GTGCTCTTCCAGTAGAAGAATAACCCAGATAAATTATTGTTACAAGAAAGGGTATGCTTG
ATCCTATGGAAGTTCACTTACTTGATTTCCCTAACATTGTCATTAAGGGTTCAGAAATGT
AGCTTCCTTTCTAATCTTGCTTAAAAGTAGAAAAGCTTGGTGATTTGATTTTGAAGGCAA
CTGAACCTTAGATGGTTGTCTTTAATTTATATGACAATTGGATGTCAAGTTGCTCATCAA
ACACAGCTTTCTCAAGACTAATTTTAGTCCTCCGTGCTCTTCACGTCAATATTGATAAAG
CTCGTATGATTCTTAAACCCAACAAGTAAGTTATCACATAACCTAATCATATTTGGCCTA
CATTAACTGATGATGAATGGGTAAAGGTAGAAAATGAATTGAAAAATTTAATTTTGGCTG
ATTACTGCAAGAAAAATAATGTCAACATTTAAGCATTGACTTAATTAGAAATTAGAGATA
TCATTCTAGGTCAAGAAATGGCTCCTCCCTCAATGAAGGACGAACAAATTAAAGAAGTTG
AAAAGTAATACAAGGAAGCTCAGCACTAGTAGGAAACTACAGTTAAAACTACAAATGTTC
TTGGAGAAGAAATTACAGTTACAGTATAAAAGCCATACGAATAGTAACAATTTAGATCTC
ATACCAACTGGAAGACTCGTGCTATTTCTGCTACTAACCTTCACTTGCGTGCTAAACATA
TCTATGTCACTAAAGTAGACATTGAAGAATCTGGATACACATACATGTTCCCTAAAAATA
TACTAAAGAAATTTATTTCTATTGCTGATTTGCAGACTCAAATCGGTGGTTTCATGTTTG
GTGTTTCACCTCCATAAAATTCATAAATTAAGGAAGTACGTTGTATAGTAATGGTACCTC
AAACTGGTAATAAAGAAAGTGTAACTTTCTGTCCTTCTTTACCTGAAGGTGGATATCTTA
AAAATCTAGAACCTCTAGGTTGGATACATACTCAATCTGAAGGTAATTTATTAACCTATT
TCAAGATTTATTTAAATTAATTGTTATCATTTTAATTTTATTAAATTTATTTATTTTTAA
TCAAATTTATAGAAAAAATGCAGCTATCACCTTATGATACAAATCTACATAGTAAATTCT
TAGCTGAAAACTAGTCTTGGAATCCTGAAGTATCCATAACATTGACTGTTTCTTTCACAC
CAGGTTCTTGCTCTCTCACTGGATATAAACTTACAAAGGCAGGTTATGAATGGGGTAAGA
AGAACAAAGACTTGCAAGCAACTCAAGGATTTACTAATACTCACTATGAAAAAGTATAGC
TTTTCCTTTCTGATAAGATTAGAGGATTCTTTATGGTTCCAGATAACCACATTTGGAACT
ATTATTCCATCGGATTGGGTGTTGTGCAAAATGCAAGTTATGCTTTGACTCTTTCCAACC
CTAAAGATTTCTATCATGAAATTCACAGAGTTAGAGATTTCATCAAGTTTAATAAAGCTG
CAGATGATGAAAACTAAGACTTAGTTGACAATGAAGATCTTTTTGAATGA