Identifiers and Description

Gene Model Identifier

TTHERM_00684450

Standard Name

PRP5 (pre-mRNA processing factor 5)

Aliases

PreTt18158 | 104.m00090 | 3732.m00004

Description

pre-mRNA processing factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF08946 ) Osmosensory transporter coiled coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00684450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17333.19.997093137033517e-262hypothetical protein (552 aa)
OxytrichaContig20238.0.g392.0001055857497602e-161WD domain, G-beta repeat
DictyBaseDDB_G02795071.99904246446894e-143plrg1 on chromosome: 3 positio
n 2174875 to 2176510
WormBaseWBGene000064811.9995317320402142e-140locus:plrg-1 status:Confirme
d UniProt:G5ECP2 protein_i
d:CBW48353.1
SGDYPL151C2.000808864924972e-124PRP46 Member of the NineTeen C
omplex (NTC) that contains Prp
19p and stabilizes U6 snRNA in
catalytic forms of the splice
osome containing U2, U5, and U
6 snRNAs
Stentor CoeruleusSteCoe_310781.4411565509640892e-64

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00684450(coding)
ATGGCTGGGATCGATCAATTAATCAACTAAGAGATATCAGACTTTACTTTAGATTCTGTT
TATAATAGTAAAAAAATGTTTATGAGCAATTTGGGCTTGAAAGTGCCTGATTTCATTGAA
AGTACTAGATTAAAATTATAAGTTAAGATTAATGATGAGTATAAATTTGCTTATGATAAG
TAGATAAAAGAGGCTTAAAAATAAGAGGAGCAAGATATCCTCAAGCTTGCAGAATAATTT
TATGATTAATCAACAGAAAGTAATGTCCTTCTTAACGAGCAAGTCCAAAAAATGCAAGAA
GAAAAGAAAATCAAGGAATTAAATGCTTAGAAAAGAAGCAATATCGAAGTAGTAATTGAA
TAAATACCTGAAAAGCAAATTGAAATTAATAAAAAGTTATCAAAACTCCCAGCTTCTTTC
CTAAAATATGGATAAAAGGCTGGATTAGATAGTCAAACTTTAGAAAAGAAAAAGGAAGAA
GAAAGACTTATGCTTACTTATTCAGGATCAGCATCTACTGCTAATAATTAATTATTATCA
TAAAGTGAGAGAGATGCTTCTAAATATCAAATAGCTAATCTATCTACTGATAACTATGTT
AAAGGAGGTGAAGTTATTGATACTGTTAGAATGGGATCTGCTATCGCAAGAAATATTACA
AAGGTTATTAAGCCTGAGTGGCATAAACCTTGGAAATTAATGAGAGTTATTGCTGGCCAC
AGAGGTTGGGTTAGGTGCGTAACTATAGATCCTGCAAATTAATTCTTTGTTACAGGATCA
AACGATAGAACAATTAAATTCTGGGATTTAGCCTCAGGATAATTGAAATTAACCCTAACT
GGCCACACATCTCCCGTTAGAGCTTTAGTAGTATCTGACAGACATCCTTACTTGTTCTCT
GCAGCCGAAGATAAAACTGTTCGTTGCTGGGATCTTGAAATGAATTAAGTCATCAGAAAC
TATCACGGACATTTATCAAGTGTTCATTCTATTTGCATTCACCCTACTTTAAACTTAATT
GCAACTGGTGGCAGAGATTGTACAATTAGATTATGGGATATAAGAGCAAGATCGTAGGTA
CATGTTTTAACTGGACATTAGCATGCTGTAGGAACTGTTATAAGTTAAGAATTTGAACCT
TAAATAGTATCAGGCTCTTATGATAATTATATTAAAACTTGGGATATTGCAGCAGGAAAA
TGTATGAAAACATTGACAAACCATAAGAAACCTGTAAAGTCTTTAGTTTTTCACCATAAA
GAATACACATTTGCTTCAGGTGCAGCTGATAATATCAAGGTTTGGAAGTGTCCCGAAGGA
GAATTTTTAAGAAATATATCATCTGGAAATGATCATATAGTAAATTCAATTGCTTTAAAT
TAGGATAATGTACTCGTTAGCGGTTGTGATGATGGTACTCTCAAATTTTGGGACTGGAAA
TCAGGATATAATTTCTAAACAATTAAATAAAAGCCATAACCTGGTTCTATAGCTGCAGAA
AATGCTATTTTTGATATGAAATTTGATAGATCATAAATGAGACTAATCACTGCTGAGTGT
GATAAAACTATAAAAGTTTATAAGGAAGATGATGAAGCTACAATGGAATCTCATCCAATA
AATGATTTTAAAGTAGAATATGGAAAGCAAGTTTATTGA


>TTHERM_00684450(protein)
MAGIDQLINQEISDFTLDSVYNSKKMFMSNLGLKVPDFIESTRLKLQVKINDEYKFAYDK
QIKEAQKQEEQDILKLAEQFYDQSTESNVLLNEQVQKMQEEKKIKELNAQKRSNIEVVIE
QIPEKQIEINKKLSKLPASFLKYGQKAGLDSQTLEKKKEEERLMLTYSGSASTANNQLLS
QSERDASKYQIANLSTDNYVKGGEVIDTVRMGSAIARNITKVIKPEWHKPWKLMRVIAGH
RGWVRCVTIDPANQFFVTGSNDRTIKFWDLASGQLKLTLTGHTSPVRALVVSDRHPYLFS
AAEDKTVRCWDLEMNQVIRNYHGHLSSVHSICIHPTLNLIATGGRDCTIRLWDIRARSQV
HVLTGHQHAVGTVISQEFEPQIVSGSYDNYIKTWDIAAGKCMKTLTNHKKPVKSLVFHHK
EYTFASGAADNIKVWKCPEGEFLRNISSGNDHIVNSIALNQDNVLVSGCDDGTLKFWDWK
SGYNFQTIKQKPQPGSIAAENAIFDMKFDRSQMRLITAECDKTIKVYKEDDEATMESHPI
NDFKVEYGKQVY


>TTHERM_00684450(gene)
ATGGCTGGGATCGATCAATTAATCAACTAAGAGATATCAGACTTTACTTTAGATTCTGTT
TATAATAGTAAAAAAATGTTTATGAGCAATTTGGGCTTGAAAGTGCCTGATTTCATTGAA
AGTACTAGATTAAAATTATAAGTTAAGATTAATGATGAGTATAAATTTGCTTATGATAAG
TAGATAAAAGAGGCTTAAAAATAAGAGGAGCAAGATATCCTCAAGCTTGCAGAATAATTT
TATGATTAATCAACAGAAAGTAATGTCCTTCTTAACGAGCAAGTCCAAAAAATGCAAGAA
GAAAAGAAAATCAAGGAATTAAATGCTTAGAAAAGAAGCAATATCGAAGTAGTAATTGAA
TAAATACCTGAAAAGCAAATTGAAATTAATAAAAAGTTATCAAAACTCCCAGCTTCTTTC
CTAAAATATGGATAAAAGGCTGGATTAGATAGTCAAACTTTAGAAAAGAAAAAGGAAGAA
GAAAGACTTATGCTTACTTATTCAGGATCAGCATCTACTGCTAATAATTAATTATTATCA
TAAAGTGAGAGAGATGCTTCTAAATATCAAATAGCTAATCTATCTACTGATAACTATGTT
AAAGGAGGTGAAGTTATTGATACTGTTAGAATGGGATCTGCTATCGCAAGAAATATTACA
AAGGTTATTAAGCCTGAGTGGCATAAACCTTGGAAATTAATGAGAGTTATTGCTGGCCAC
AGAGGTTGGGTTAGGTGCGTAACTATAGATCCTGCAAATTAATTCTTTGTTACAGGATCA
AACGATAGAACAATTAAATTCTGGGATTTAGCCTCAGGATAATTGAAATTAACCCTAACT
GGCCACACATCTCCCGTTAGAGCTTTAGTAGTATCTGACAGACATCCTTACTTGTTCTCT
GCAGCCGAAGATAAAACTGTTCGTTGCTGGGATCTTGAAATGAATTAAGTCATCAGAAAC
TATCACGGACATGTAAATTAAATAATATTTATAAATTAATTTTAAAAGTTACTTGTTAAT
TTGAAAAAATGAATTAATTATAATGAATTTTATTTAAATTAGTTATCAAGTGTTCATTCT
ATTTGCATTCACCCTACTTTAAACTTAATTGCAACTGGTGGCAGAGATTGTACAATTAGA
TTATGGGATATAAGGTAGCATATTCAAAATTAAATTAGATATAAAATAATATTTTTTATC
TTAAAATAGAGCAAGATCGTAGGTACATGTTTTAACTGGACATTAGCATGCTGTAGGAAC
TGTTATAAGTTAAGAATTTGAACCTTAAATAGTATCAGGCTCTTATGATAATTATATTAA
AACTTGGGATATTGCAGCAGGAAAATGTATGAAAACATTGACAAACCATAAGAAACCTGT
AAAGTCTTTAGTTTTTCACCATAAAGAATACACATTTGCTTCAGGTGCAGCTGATAATAT
CAAGGTTTGGAAGTGTCCCGAAGGAGAATTTTTAAGAAATATATCATCTGGAAATGATCA
TATAGTAAATTCAATTGCTTTAAATTAGGATAATGTACTCGTTAGCGGTTGTGATGATGG
TAATTTAAGATTAAATTTTATCAATATTGATTAAAAAATAATTAAAATATAAAAGGTACT
CTCAAATTTTGGGACTGGAAATCAGGATATAATTTCTAAACAATTAAATAAAAGCCATAA
CCTGGTTCTATAGCTGCAGAAAATGCTATTTTTGATATGAAATTTGATAGATCATAAATG
AGGTAAGCTAAACAAACATAAAAAATTTTAATTTCTAATAATTATATTTTTAAAATAGAC
TAATCACTGCTGAGTGTGATAAAACTATAAAAGTTTATAAGGAAGATGATGAAGCTACAA
TGGAATCTCATCCAATAAATGATTTTAAAGTAGAATATGGAAAGCAAGTTTATTGA