Identifiers and Description

Gene Model Identifier

TTHERM_00700970

Standard Name

PRP4 (pre-mRNA processing factor 4)

Aliases

PreTt14894 | 109.m00112

Description

U4/U6 small nuclear ribonucleoprotein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01839 ) FG-GAP repeat
  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF08799 ) pre-mRNA processing factor 4 (PRP4)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00700970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01239.19.997093137033517e-262hypothetical protein (536 aa)
OxytrichaContig6514.0.g507.002925050786358e-139WD domain, G-beta repeat
WormBaseWBGene000079721.999469658314961e-75locus:prp-4 status:Partially
_confirmed UniProt:Q93339
protein_id:CAB02270.1
DictyBaseDDB_G02876356.000034430729774e-56prpf4 on chromosome: 5 positio
n 533367 to 535169
SGDYPR178W7.997143886232904e-48PRP4 Splicing factor, componen
t of the U4/U6-U5 snRNP comple
x
Stentor CoeruleusSteCoe_340054.359610000063081e-28

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00700970(coding)
ATGTCTTCAGATAAGCAAGAAGAGAGAATCTATTATGGTTCTCTTGAAGAATAGGAGAGA
CAAAGAATAATAGATGAAGAAAAGCAAAAATAAGAAAGAAAATAGCAATAAGCTTCTCAA
TCTGCTCCTAATAGCAGCTCAGATTAATAATAATCATAATAAGTCTAAACAGGATAATTA
AAAAGCTTGGGAGGAAAGTAATTAAAATCTTTAGCTGACAAAGATAAGTCACAAACAAAT
GTGTAGATAGAAGTATTGGAATTATCAGAACATGCTCTAGAAGAAAAGAGAAGACATGAT
GAAAATATGAGAAAGTTAGAACTTCAAAAAAAAGCATCAACTATGATTGTACCTACAAAT
GATAAAGAAGTAAAATATAGATTGAGATAATTAGGTCATCCTATTTGCTACTTTGGTGAA
AATAATGCTGACAGAAGAGAGCGTTTGAAAAAGGTTTAAGCTGAATATATTATGGAACAC
GGCGATTTACCTCAATTTATTAAATTAGAAGAAAAGCAAAAGTAAAATGATGAGAATGAA
CATTTCTACTACCCAGGTATTAAAGAATTGAAAGAAATTAGAGAAGAAATAGCTACTTAC
TCTCTTCTTAAGTCTTCGCGTAGAGTCTATAAATCTAAAGTTGGTAGAATGGAGGAAGAC
CCATTAGTAGAAGAAAAAAAGCAAATTAGTTCTCTCAACAGAGCTATGAAATTTGATGTT
TGTGTTAGTTAATTCGCTGATTCAAGTATTGTTTTAAGAGGTGCTTTTTCTCCTGAATGT
GATCTTTTAGCAACAGCAGGCGGTTCTGGAGTCTCCAAAATATGGAATATTCCTAATTCA
GATTTAAAATGCAGATTAGAAGGCCATCTTAGTAAGGTCCATGATATTGTTTGGAATCCA
GAAACAGGTAGTATGAGTCATAACTCTTTTGGGCATTTGGCTACAGGATCTAGTGATACA
AATATTCGTTTATGGACTATGGACCCTGCTGCTGAATTATAAAAATCAATTGTTTTAAGT
GGACATGAAGATAGAGTTAATAGACTCAGTTTCCATCAAACAGGAAAATATCTCTTTTCT
ACTTCTCACGATATGACTTGGCGTTTTTGGGACATCGAGCGTCAGAAAGAAATTTACGTA
TAAACTGGTCATACTAAAGGAGTATATGCTAATGCACTTCATCCTGATGGATCTCTTATT
TTTACAGGAGATCTCTAAGGTTATGGAATGATTTGGGATTTAAGAACTGGTAAAGGTATA
CTACCTTTTTCAGGTTATCATGTTAAAGGTATTTTAGCAGCTGATTTCTCTGAAAATGGT
TTCTAATTTGTAACTGGTAGTGAAGATAATACACTTAGAGTATTCGATATTAGAAGAAGG
GCTTGTATGCATACTCTTCCTGGTCATCTTAAACTTATCAGTGATGTTAAATTTTAGAAA
AATGGAAGCAATTACTTTGTCTCTGTTAGTTATGACAACACACTCAAATTATGGAATGCA
AAAGACTTTTCACTAGCCAAAACATATAAATCCCACGAATCTAAAATCACTTCAGTTACC
TTGGATTAATCTCAGAAGTATTTTGCAACTACATCTCTAGATAGAAAGTGGATGTTATGG
GAATATAAAGATTTCTGA


>TTHERM_00700970(protein)
MSSDKQEERIYYGSLEEQERQRIIDEEKQKQERKQQQASQSAPNSSSDQQQSQQVQTGQL
KSLGGKQLKSLADKDKSQTNVQIEVLELSEHALEEKRRHDENMRKLELQKKASTMIVPTN
DKEVKYRLRQLGHPICYFGENNADRRERLKKVQAEYIMEHGDLPQFIKLEEKQKQNDENE
HFYYPGIKELKEIREEIATYSLLKSSRRVYKSKVGRMEEDPLVEEKKQISSLNRAMKFDV
CVSQFADSSIVLRGAFSPECDLLATAGGSGVSKIWNIPNSDLKCRLEGHLSKVHDIVWNP
ETGSMSHNSFGHLATGSSDTNIRLWTMDPAAELQKSIVLSGHEDRVNRLSFHQTGKYLFS
TSHDMTWRFWDIERQKEIYVQTGHTKGVYANALHPDGSLIFTGDLQGYGMIWDLRTGKGI
LPFSGYHVKGILAADFSENGFQFVTGSEDNTLRVFDIRRRACMHTLPGHLKLISDVKFQK
NGSNYFVSVSYDNTLKLWNAKDFSLAKTYKSHESKITSVTLDQSQKYFATTSLDRKWMLW
EYKDF


>TTHERM_00700970(gene)
ATGTCTTCAGATAAGCAAGAAGAGAGAATCTATTATGGTTCTCTTGAAGAATAGGAGAGA
CAAAGAATAATAGATGAAGAAAAGCAAAAATAAGAAAGAAAATAGCAATAAGCTTCTCAA
TCTGCTCCTAATAGCAGCTCAGATTAATAATAATCATAATAAGTCTAAACAGGATAATTA
AAAAGCTTGGGAGGAAAGTAATTAAAATCTTTAGCTGACAAAGATAAGTCACAAACAAAT
GTGTAGATAGAAGTATTGGAATTATCAGAACATGCTCTAGAAGAAAAGAGAAGACATGAT
GAAAATATGAGAAAGTTAGAACTTCAAAAAAAAGCATCAACTATGATTGTACCTACAAAT
GATAAAGAAGTAAAATATAGATTGAGATAATTAGGTCATCCTATTTGCTACTTTGGTGAA
AATAATGCTGACAGAAGAGAGCGTTTGAAAAAGGTTTAAGCTGAATATATTATGGAACAC
GGCGATTTACCTCAATTTATTAAATTAGAAGAAAAGCAAAAGTAAAATGATGAGAATGAA
CATTTCTACTACCCAGGTATTAAAGAATTGAAAGAAATTAGAGAAGAAATAGCTACTTAC
TCTCTTCTTAAGTCTTCGCGTAGAGTCTATAAATCTAAAGTTGGTAGAATGGAGGAAGAC
CCATTAGTAGAAGAAAAAAAGCAAATTAGTTCTCTCAACAGAGCTATGAAATTTGATGTT
TGTGTTAGTTAATTCGCTGATTCAAGTATTGTTTTAAGAGGTGCTTTTTCTCCTGAATGT
GATCTTTTAGCAACAGCAGGCGGTTCTGGAGTCTCCAAAATATGGAATATTCCTAATTCA
GATTTAAAATGCAGATTAGAAGGCCATCTTAGTAAGGTCCATGATATTGTTTGGAATCCA
GAAACAGGTAGTATGAGTCATAACTCTTTTGGGCATTTGGCTACAGGATCTAGTGATACA
AATATTCGTTTATGGACTATGGACCCTGCTGCTGAATTATAAAAATCAATTGTTTTAAGT
GGACATGAAGATAGAGTTAATAGACTCAGTTTCCATCAAACAGGAAAATATCTCTTTTCT
ACTTCTCACGATATGACTTGGCGTTTTTGGGACATCGAGCGTCAGAAAGAAATTTACGTA
TAAACTGGTCATACTAAAGGAGTATATGCTAATGCACTTCATCCTGATGGATCTCTTATT
TTTACAGGAGATCTCTAAGGTTATGGAATGATTTGGGATTTAAGAACTGGTAAAGGTATA
CTACCTTTTTCAGGTTATCATGTTAAAGGTATTTTAGCAGCTGATTTCTCTGAAAATGGT
TTCTAATTTGTAACTGGTAGTGAAGATAATACACTTAGAGTATTCGATATTAGAAGAAGG
GCTTGTATGCATACTCTTCCTGGTCATCTTAAACTTATCAGTGATGTTAAATTTTAGAAA
AATGGAAGCAATTACTTTGTCTCTGTTAGTTATGACAACACACTCAAATTATGGAATGCA
AAAGACTTTTCACTAGCCAAAACATATAAATCCCACGAATCTAAAATCACTTCAGTTACC
TTGGATTAATCTCAGAAGTATTTTGCAACTACATCTCTAGATAGAAAGTGGATGTTATGG
GAATATAAAGATTTCTGA