Identifiers and Description

Gene Model Identifier

TTHERM_00294730

Standard Name

PRP38 (pre-mRNA splicing factor PRP38)

Aliases

PreTt15583 | 27.m00243 | 3692.m00046

Description

pre-mRNA splicing factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03371 ) PRP38 family
  • ( TIGR00255 ) conserved hypothetical protein TIGR00255

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00294730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08730.19.997093137033517e-262hypothetical protein (1176 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00294730(coding)
ATGATTTAGTAGTCTACTTAATAAAATAATTTAAACAATAGATAGTCTAATTTGAAAATA
AATGAGTAAAATAACTAAACAAGTAATTAAATGTTTGCTAAAGGAAGCTAAGTGTACGGA
TAAACGCCAGGAGGAATGTCTGAAATTAGAAACATTTAAAATAATAGAACGCCATAAGGT
TTTGACTAAGAATACTATAGTAGTAATCAACAATATTAATATTAGCAAAGTTAGTAAGGG
CTCTACTCACAATGGGATGATACAAAAAATAACTAATTTATTCAATAAACTCCTAATGCT
TAGATAAATAATTAATATAATAATTAGAAGTAAAAAAATGATAGGATCTAATAGGATTAT
AATCAAGATAGATTTTAATAACAGTAGTTAAATTTAACTTAAAGCCATAACATTTACAAG
GATTATCCTCCTGAAAACAATCAAACATAATTTTATAAATAAAGTAATTATTAATAGAAT
CCAAGTTAATAAATGGGCTATAATATTTACACGCCCAACCCAGAAACGCAAAAGAAAAAT
GAATCTCAGATAAGATAATCAAATTAATAGATATTACAACAATAAGAAAATAGTGGATAA
AATGGAAGCTAATATAGATATGAAACACCTATAAGAAATTAAACTCCGATCTAAGAGTAG
CTGAGGTTTTCACAGAATAAATAAGATTCAAATGATCCAAACTTAGAAGATTTGTAAGTA
AGTAACATCCCAGTATCATTACCTGTAAAGATATAGGGAAGTATTATCAATCTTGATTCC
AAAATTTCTTAAAGTAATTTAAATAATAAAGATATGACTTTTTAAATCAACAATTCTAGC
AGGAACTATCAGCTACCTGATAATTAAAGATAAAGTCACTCATTTAATACAAGCAATTAT
CCTCTTATTAATCCGACTGAATCTCAAAGAGAATAATCATCGGGATATTTTTATAAGTAA
CAAAGCTAATAAAAGCAAATGAATAATCAACAAGCTTTCAATCCAGATGAAGATGTCAAG
CAAAATTTAAATTAGTATGATTTTGATGATGATACAAATATGAACAATTCTAACAATCCA
TTAAATAATATAGTTCCTTAAACGATTAATTATCATCCAAGTAAAATAAAAACTAAATCA
GGAAATTTTAATTACAAAAACTAGTAAAAACCAGATGCAAGTTATGAACATAAAGATGAA
GCTATACTATGTTTAGATGAAACTGAATAACTTTAAGATGAGAACAGCAATAATCTAATA
GTCTCAAGCTATCAAAGAGATAGTAATAAATGCAAACTATATAGCTAATATAATGATTTT
AGTAATAATAATTAGCAAAGGGATGCTGATTACTACAGATCTGATAATGGAAGAAAAGAA
TCACTATTTAAATATGACCCATCCATGTTTTAATCAATTACAGGTTATTTCTATCCTTCT
GTTGGAACATAGTAAGCAATAGCTGCCAGTTTTAATAAAGATGAAGCTTTACTAAGCTTG
AACAAGTTTTACTAAAATTAACCATAAAAACTGTAAATGTTTTAATCATTGATTTAGAAA
TATTTGGTGGAATAAGAAAGGGTTTTCATTTAAAGGATAAATAGAGAGATATCTGGATTA
TAAAGTGCTGAAAACTTGGGTGATTTTTTTATCCATAAATATAAAAACAATTTACAAAAA
AGGGTTGCGGGGTGCTCTCGTGCCTAAATATTTCCTGTTTATATTGGTGTCCGTGGAGAT
GGAAATTGTTTTTATAGAGCACTTATTGTAAATTATTTAGTCATTCTATTAAGCAAATAT
GATACACTTGATTAATTTGAATAGCTAATAATCGATATTTATAACAATAAGCATCCATTA
ATTGATTTAGAATATTAGGGTTAGACAAGAAGTGATAGAGATAACGTAAAAATTATTCTT
ATGTAACAATTTTTGCTTCTTCTGATAGAACGTATGTAGGCAACAACAAAGGAAGAAATA
TCTTTATTTTTAATGAAAATGTTTGATAGTATATCAAGTGACCATGATTTTGATTACTCT
CTTGTTGCACTTTGCCGCTCTATGATCTTATATGCCCTAGAAAAATATGGAACCCATCAA
GTTTATCAAGAATACTTAATTTAAGAGGATATTGAATAGACTCGTATAAAATTATGTACT
TATAAAGAAGATGCTGAATACCATGCAATCAGTTTAAGTACTGAAATATTTAGACATCCT
ATATAGATAATTTAGCTTTAGAAAGATAAATTTGGTAATTTTGAATTTAATGAAAAAGTA
ATCTATCAGCCTAACGTGAACTAACCAGCTCAAGGTAATATATACATTTTACTGAATGAT
GGGCATTATGATTTAGTTTTTGATAGAGAAACATGTCTTGACTATTTTCCTTCTTTGAGC
TTATTCAACAACCATTAGTAATATCATGATGATTTAGAGCTTCTCATTAAATAACCAGGC
ATTTAACAAAATTTAAGATAGTACTACATATAATTGATGGCAGAATATGAAAAATTCCTA
AAAGACTAAAGCAATCAAGCAGTTAAAGTTAGAGAATCATATATTAATTTACAAACTCTA
TATTAAACCAAAATAGGTAGAATTTCCTCAGTATCATCTATTTTAAATCACTAAGAAAAT
TAAGAAAATCTTGTTTCTAAAGTAAATAATAATCAATAACAAAATCATTTAGTCCTTTTT
GATTCTATTATTTCTCAATCTCAATCTCAACTTAAAGGATAAAACACAAGCTAGCTTCTA
TAAAGTGATGGTAAAAAAATTGATAATATGGGGTCTTCAAATGAAAAGCTTTTTTCTTAA
AGAGATGGAGATACTTTTAATTAGAATTTATTTGTAAAAAGATAAACATAATAAAATGAA
ACGTAACTCTATTAAGAAGATCACAAAGAGTTAAAATTAAAATCTAATACTTAAGATACA
TAAACAGATACTCCTAATATGTAAAGCTAAATGCATATGAAATCTACAGATGATTCTTCT
AACTATACATTCCAAGGTGAGGGTATAAATTTTAAAAGTAACTTCTATAATTTACATAGT
GATAAACTACAAAAGCAGTAAAATTTTTCTTTGACACCTAATCCCCCTTCAATAATCAGT
GATGGTTCGAAAAAGGAACCAAAAATATAGAAGTAATAACAAAATAATGATGTATTTTTA
CCATGTGATCATGCTGGGTATAACGATGTGGTTATAAAATCAATAACATGCTGTAAAGTT
AATTACGAAATCTGTTATCCTTGCTTTAAAACTAGATAAATTATCAAATGTTAATTTTGC
AACAAAGAACTACTAAGCAACAGTAGGATAGCTTAGACAAGTAAGAATAAACTTATTTAT
TGTAAGAAATGTGAGTAGAAAACAGATTTAGTAATACTATTTAATAAAATATATTGTAAA
GCATGTGTTAGCGATTAAAAGTGA


>TTHERM_00294730(protein)
MIQQSTQQNNLNNRQSNLKINEQNNQTSNQMFAKGSQVYGQTPGGMSEIRNIQNNRTPQG
FDQEYYSSNQQYQYQQSQQGLYSQWDDTKNNQFIQQTPNAQINNQYNNQKQKNDRIQQDY
NQDRFQQQQLNLTQSHNIYKDYPPENNQTQFYKQSNYQQNPSQQMGYNIYTPNPETQKKN
ESQIRQSNQQILQQQENSGQNGSQYRYETPIRNQTPIQEQLRFSQNKQDSNDPNLEDLQV
SNIPVSLPVKIQGSIINLDSKISQSNLNNKDMTFQINNSSRNYQLPDNQRQSHSFNTSNY
PLINPTESQREQSSGYFYKQQSQQKQMNNQQAFNPDEDVKQNLNQYDFDDDTNMNNSNNP
LNNIVPQTINYHPSKIKTKSGNFNYKNQQKPDASYEHKDEAILCLDETEQLQDENSNNLI
VSSYQRDSNKCKLYSQYNDFSNNNQQRDADYYRSDNGRKESLFKYDPSMFQSITGYFYPS
VGTQQAIAASFNKDEALLSLNKFYQNQPQKLQMFQSLIQKYLVEQERVFIQRINREISGL
QSAENLGDFFIHKYKNNLQKRVAGCSRAQIFPVYIGVRGDGNCFYRALIVNYLVILLSKY
DTLDQFEQLIIDIYNNKHPLIDLEYQGQTRSDRDNVKIILMQQFLLLLIERMQATTKEEI
SLFLMKMFDSISSDHDFDYSLVALCRSMILYALEKYGTHQVYQEYLIQEDIEQTRIKLCT
YKEDAEYHAISLSTEIFRHPIQIIQLQKDKFGNFEFNEKVIYQPNVNQPAQGNIYILLND
GHYDLVFDRETCLDYFPSLSLFNNHQQYHDDLELLIKQPGIQQNLRQYYIQLMAEYEKFL
KDQSNQAVKVRESYINLQTLYQTKIGRISSVSSILNHQENQENLVSKVNNNQQQNHLVLF
DSIISQSQSQLKGQNTSQLLQSDGKKIDNMGSSNEKLFSQRDGDTFNQNLFVKRQTQQNE
TQLYQEDHKELKLKSNTQDTQTDTPNMQSQMHMKSTDDSSNYTFQGEGINFKSNFYNLHS
DKLQKQQNFSLTPNPPSIISDGSKKEPKIQKQQQNNDVFLPCDHAGYNDVVIKSITCCKV
NYEICYPCFKTRQIIKCQFCNKELLSNSRIAQTSKNKLIYCKKCEQKTDLVILFNKIYCK
ACVSDQK


>TTHERM_00294730(gene)
ATGATTTAGTAGTCTACTTAATAAAATAATTTAAACAATAGATAGTCTAATTTGAAAATA
AATGAGTAAAATAACTAAACAAGTAATTAAATGTTTGCTAAAGGAAGCTAAGTGTACGGA
TAAACGCCAGGAGGAATGTCTGAAATTAGAAACATTTAAAATAATAGAACGCCATAAGGT
TTTGACTAAGAATACTATAGTAGTAATCAACAATATTAATATTAGCAAAGTTAGTAAGGG
CTCTACTCACAATGGGATGATACAAAAAATAACTAATTTATTCAATAAACTCCTAATGCT
TAGATAAATAAGTACCATTTTTTATTAGTATTAGCTAAATACTTTAAATTATTTTTATTT
TCCAGTTAATATAATAATTAGAAGTAAAAAAATGATAGGATCTAATAGGATTATAATCAA
GATAGATTTTAATAACAGTAGTTAAATTTAACTTAAAGCCATAACATTTACAAGGATTAT
CCTCCTGAAAACAATCAAACATAATTTTATAAATAAAGTAATTATTAATAGAATCCAAGT
TAATAAATGGGCTATAATATTTACACGCCCAACCCAGAAACGCAAAAGAAAAATGAATCT
CAGATAAGATAATCAAATTAATAGATATTACAACAATAAGGTAACATTGTAAAGAAATTT
TAATTCTCTATTTCAATTTAGAGCACTTGAAATTAATATTGAAATTTATTAAGATTTTTG
CTTTTTAAAATAGAAAATAGTGGATAAAATGGAAGCTAATATAGATATGAAACACCTATA
AGAAATTAAACTCCGATCTAAGGTGATACTATCTTTATATTCAATTTTTGTATTTTTAAA
AACAATAATAAATTCTTAATATATTCCATAATAAAGAGTAGCTGAGGTTTTCACAGAATA
AATAAGATTCAAATGATCCAAACTTAGAAGATTTGTAAGTAAGTAACATCCCAGTATCAT
TACCTGTAAAGATATAGGGAAGTATTATCAATCTTGATTCCAAAATTTCTTAAAGTAATT
TAAATAATAAAGATATGACTTTTTAAATCAACAATTCTAGCAGGAACTATCAGCTACCTG
ATAATTAAAGATAAAGTCACTCATTTAATACAAGCAATTATCCTCTTATTAATCCGACTG
AATCTCAAAGAGAATAATCATCGGGATATTTTTATAAGTAACAAAGCTAATAAAAGCAAA
TGAATAATCAACAAGCTTTCAATCCAGATGAAGATGTCAAGCAAAATTTAAATTAGTATG
ATTTTGATGATGATACAAATATGAACAATTCTAACAATCCATTAAATAATATAGTTCCTT
AAACGATTAATTATCATCCAAGTAAAATAAAAACTAAATCAGGAAATTTTAATTACAAAA
ACTAGTAAAAACCAGATGCAAGTTATGAACATAAAGATGAAGCTATACTATGTTTAGATG
AAACTGAATAACTTTAAGATGAGAACAGCAATAATCTAATAGTCTCAAGCTATCAAAGAG
ATAGTAATAAATGCAAACTATATAGCTAATATAATGATTTTAGTAATAATAATTAGCAAA
GGGATGCTGATTACTACAGATCTGATAATGGAAGAAAAGAATCACTATTTAAATATGACC
CATCCATGTTTTAATCAATTACAGGTTATTTCTATCCTTCTGTTGGAACATAGTAAGCAA
TAGCTGCCAGTTTTAATAAAGATGAAGCTTTACTAAGCTTGAACAAGTTTTACTAAAATT
AACCATAAAAACTGTAAATGTTTTAATCATTGATTTAGAAATATTTGGTGGAATAAGAAA
GGGTTTTCATTTAAAGGATAAATAGAGAGATATCTGGATTATAAAGTGCTGAAAACTTGG
GTGATTTTTTTATCCATAAATATAAAAACAATTTACAAAAAAGGGTTGCGGGGTGCTCTC
GTGCCTAAATATTTCCTGTTTATATTGGTGTCCGTGGAGATGGAAATTGTTTTTATAGAG
CACTTATTGTAAATTATTTAGTCATTCTATTAAGCAAATATGATACACTTGATTAATTTG
AATAGCTAATAATCGATATTTATAACAATAAGCATCCATTAATTGATTTAGAATATTAGG
GTTAGACAAGAAGTGATAGAGATAACGTAAAAATTATTCTTATGTAACAATTTTTGCTTC
TTCTGATAGAACGTATGTAGGCAACAACAAAGGAAGAAATATCTTTATTTTTAATGAAAA
TGTTTGATAGTATATCAAGTGACCATGATTTTGATTACTCTCTTGTTGCACTTTGCCGCT
CTATGATCTTATATGCCCTAGAAAAATATGGAACCCATCAAGTTTATCAAGAATACTTAA
TTTAAGAGGATATTGAATAGACTCGTATAAAATTATGTACTTATAAAGAAGATGCTGAAT
ACCATGCAATCAGTTTAAGTACTGAAATATTTAGACATCCTATATAGATAATTTAGCTTT
AGAAAGATAAATTTGGTAATTTTGAATTTAATGAAAAAGTAATCTATCAGCCTAACGTGA
ACTAACCAGCTCAAGGTAATATATACATTTTACTGAATGATGGGCATTATGATTTAGTTT
TTGATAGAGAAACATGTCTTGACTATTTTCCTTCTTTGAGCTTATTCAACAACCATTAGT
AATATCATGATGATTTAGAGCTTCTCATTAAATAACCAGGCATTTAACAAAATTTAAGAT
AGTACTACATATAATTGATGGCAGAATATGAAAAATTCCTAAAAGACTAAAGCAATCAAG
CAGTTAAAGTTAGAGAATCATATATTAATTTACAAACTCTATATTAAACCAAAATAGGTA
GAATTTCCTCAGTATCATCTATTTTAAATCACTAAGAAAATTAAGAAAATCTTGTTTCTA
AAGTAAATAATAATCAATAACAAAATCATTTAGTCCTTTTTGATTCTATTATTTCTCAAT
CTCAATCTCAACTTAAAGGATAAAACACAAGCTAGCTTCTATAAAGTGATGGTAAAAAAA
TTGATAATATGGGGTCTTCAAATGAAAAGCTTTTTTCTTAAAGAGATGGAGATACTTTTA
ATTAGAATTTATTTGTAAAAAGATAAACATAATAAAATGAAACGTAACTCTATTAAGAAG
ATCACAAAGAGTTAAAATTAAAATCTAATACTTAAGATACATAAACAGATACTCCTAATA
TGTAAAGCTAAATGCATATGAAATCTACAGATGATTCTTCTAACTATACATTCCAAGGTG
AGGGTATAAATTTTAAAAGTAACTTCTATAATTTACATAGTGATAAACTACAAAAGCAGT
AAAATTTTTCTTTGACACCTAATCCCCCTTCAATAATCAGTGATGGTTCGAAAAAGGAAC
CAAAAATATAGAAGTAATAACAAAATAATGATGTATTTTTACCATGTGATCATGCTGGGT
ATAACGATGTGGTTATAAAATCAATAACATGCTGTAAAGTTAATTACGAAATCTGTTATC
CTTGCTTTAAAACTAGATAAATTATCAAATGTTAATTTTGCAACAAAGAACTACTAAGCA
ACAGTAGGATAGCTTAGACAAGTAAGAATAAACTTATTTATTGTAAGAAATGTGAGTAGA
AAACAGATTTAGTAATACTATTTAATAAAATATATTGTAAAGCATGTGTTAGCGATTAAA
AGTGA