Identifiers and Description

Gene Model Identifier

TTHERM_00113340

Standard Name

PRP31 (pre-mRNA processing factor 31)

Aliases

PreTt27148 | 8.m00408 | 3812.m02442

Description

SnoRNA binding domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00113340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03897.19.997093137033517e-262SnoRNA binding domain-containi
ng protein (538 aa)
OxytrichaContig11690.0.g123.999413844471248e-84Putative snoRNA binding domain
WormBaseWBGene000224589.997863464222902e-69locus:prp-31 status:Confirme
d UniProt:Q9N592 protein_i
d:CCD66198.1
DictyBaseDDB_G02895951.0000310450948521e-65prpf31 on chromosome: 5 positi
on 2984110 to 2985612
SGDYGR091W3.0001084582952455e-37PRP31 Splicing factor, compone
nt of the U4/U6-U5 snRNP compl
ex
Stentor CoeruleusSteCoe_374632.8625185805493937e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00113340(coding)
ATGAATCAAGACTTTTTGAAAGATTTAGATGATTTGGATGATGATGAGGAAATAGTTGTA
GATGATGGGTATGGCGATGATGATAACAATGAAGAAGATGAAATGAATGATGAAGATTTG
TAGAATCTTGAAGGTTTTGATGATGAGGATTTGGAGGGTGATAATCTAGAAGAATAAATT
GTTAAAAAAGTAAAAACACAAAATAGAGAAAATGAAAAGGAAAATGCTATTTAAGAGTTT
AAGACAGCTTTTTAAAAAGTTTAATCCAAGCCTATTTCAAATTTACTAAATGATGCTGAG
TTCAAAAAGCTCTATCAAAAAATCCAAGAGTATAAAGGAAAATAAAATGTTTCTAACTTG
ACAGCTCAAGATGATGAATATCATGTTATAATAAGATCAAATGAATATGCTGCTATTATT
GAAAGAGAAATCTAAGCTGTGCATAAATTTGCAAAGGACATCTTCTTAAAGAGATTAGCT
GAATTGCAAGATATTGTTATCAATCCTATTGATTATGCAAAATGTGTCAAGTTAATTAAA
AATGAATCGGATATCATGAAATTAGATTTTTCTAGCATTCCTACATTAACTATGCAGTAA
ATTACTTCTATTTCTGTTGCAGCTTCGCAAGAAGAAGGAAAGTATTTAAATGCTAGCGAA
TACAAATAAGTCATAGCTGCTTGTGACAATATTTTAGAACTTCACGAGATGTCATTATAA
ATATAAGCTTACATAGAGAGTCGTATGAAATTTATTGCTCCAAATTTAAGTGCTCTCGTA
GGAAGTACTTGTGCTTCTCGTTTGGTTACAGCAGCTGGTGGTGTGGAAGCTCTCTAAAGA
ATGCCTGCTTGCAATATCTAAGTTATGGGTTCCTAGAAAAAATCACTGTTAGGTATGTCT
AAAGAAGGATAAGGAAATAACAGAGGTTATTTCGCATAATTAGAAATGGTCTAAAAAGCT
CCTCCCTAGTTTTAGACAAAACTAGTCAGAATGCTTTCTACTAATGTTGCAAAAGCTGTT
CGTATTGATTTCTTGAAGACATGTCCTAGTGGATCTGCTGGAAAAAGATTGTATGATTTA
ATGATTTAAAGATTCTCAAAAGTCTAAGAACCTCCTCCAGCCAAGATGAACAAACCTTTA
GCTAAACCTGATGACAAGCCCAGCAGAAAAAGAGGTGGTGAGAAATATAGAAAGATTAAA
GAGCGTTTAGGATTAACTAATTTGAGAGCTTTATCACAAAGAATGATGTTTGGTGATTAA
GCAGAAGAAGAATTTAGAGACACAGGAAAGGGCTTTGGTCTATTGGGAGTTTAAGCTGGT
ACTATTAAGGTCAATGTAAGCAAGAGGAAGATTAAATTAAGTAATGTTATTAAATTTTAT
TTATATATTCTAAATTTAATATAAAAATAGCTCAAAAGCAATAAAAGCAGCAAGCTAAAT
AAGAATAAAGATAGGTTCCACTTAAAATAGCTGGCGGAGATATGCAAGATGGTCTTGCAT
CTAGCTTATAATTTACTTCAAATTAGGGAATAGAACTTATAAATCCTTACCTTCTCAAGC
AAGATGGTATCAAGACAGAAAATTATTTTAACAAAGATGTTGGTTTCAGAACTGTTGTAG
AAACAAAAAACAATGTAGGCTTACTCCCAGGTCAATTTAAGGCTCCTAATTGAGTTTACT
ACTTAATCTATCTTAAAATTTAAATGTTGGTTGTGTTTGTTTTTAAACTTGTTTTTCATA
AAAATTATCTTTAAATTTGCAATAAAAGTTGTTTAAAATTTTTAAAAAAATAATTAGGGT
GTTTTTTTTGTTTTAAACAGTAAAAATTAGTAAAAAAATTAATTTTTGCTAAAATTTACT
CAAAAAAATTTAGTTTGA


>TTHERM_00113340(protein)
MNQDFLKDLDDLDDDEEIVVDDGYGDDDNNEEDEMNDEDLQNLEGFDDEDLEGDNLEEQI
VKKVKTQNRENEKENAIQEFKTAFQKVQSKPISNLLNDAEFKKLYQKIQEYKGKQNVSNL
TAQDDEYHVIIRSNEYAAIIEREIQAVHKFAKDIFLKRLAELQDIVINPIDYAKCVKLIK
NESDIMKLDFSSIPTLTMQQITSISVAASQEEGKYLNASEYKQVIAACDNILELHEMSLQ
IQAYIESRMKFIAPNLSALVGSTCASRLVTAAGGVEALQRMPACNIQVMGSQKKSLLGMS
KEGQGNNRGYFAQLEMVQKAPPQFQTKLVRMLSTNVAKAVRIDFLKTCPSGSAGKRLYDL
MIQRFSKVQEPPPAKMNKPLAKPDDKPSRKRGGEKYRKIKERLGLTNLRALSQRMMFGDQ
AEEEFRDTGKGFGLLGVQAGTIKVNVSKRKIKLSNVIKFYLYILNLIQKQLKSNKSSKLN
KNKDRFHLKQLAEICKMVLHLAYNLLQIREQNLQILTFSSKMVSRQKIILTKMLVSELLQ
KQKTMQAYSQVNLRLLIEFTTQSILKFKCWLCLFLNLFFIKIIFKFAIKVVQNFQKNNQG
VFFVLNSKNQQKNQFLLKFTQKNLV


>TTHERM_00113340(gene)
ATGGTAAAAATAGCATCTTACTTTTGAAAAATTTCACAGTCTTTTATGGTTAAAATATAG
GAATTTTAATAATCATTTTGAAGTTAAAGTGTCGTTAAAATAAGTTAGGATGAGATAGTT
TCAAGGCTAATCTATTTATTGATTAGAAACAAATATTCCTAAATGAATCAACAATTTCCA
ACAAATTTGCAATAAAAAATCTACTTCTATGAATTTTGTTTGAATCCTTAAATAGGATTA
ATAATGAAAGAAAATATAATATAAAAGATGAATAAATTATTCCAATTAGCGATAAGAATA
AACTTCCTAAATTCATTTATAAATTATTATGATTTTGGTTGAAAATAAAAATATTTGTTT
GCCAGCCAAACGAAGCTTATATTTAATGATAATAAAGTTCTATATATTTATAACCATAGA
GACTGAAAATATATAAGTGAAATAACTTCTAACATTTTTAAAAAATAAATTAGAATCAAG
ACTTTTTGAAAGATTTAGATGATTTGGATGATGGTAATTAAATTTTATTTCAATTTTAAT
ATTTATTTATTAAAAAATTATTTGTTTAAATTAACAAAGATGAGGAAATAGTTGTAGATG
ATGGGTATGGCGATGATGATAACAATGAAGAAGATGAAATGAATGATGAAGATTTGTAGA
ATCTTGAAGGTTTTGATGATGAGGATTTGGAGGGTGATAATCTAGAAGAATAAATTGTTA
AAAAAGTAAAAACACAAAATAGAGAAAATGAAAAGGAAAATGCTATTTAAGAGTTTAAGA
CAGCTTTTTAAAAAGTTTAATCCAAGCCTATTTCAAATTTACTAAATGATGCTGAGTTCA
AAAAGCTCTATCAAGTAAAATTAATTTCAAGATTTTTCATCTTATTTATCTTCTTAATTT
GTAGAAAATCCAAGAGTATAAAGGAAAATAAAATGTTTCTAACTTGACAGCTCAAGATGA
TGAATATCATGTTATAATAAGATCAAATGAATATGCTGCTATTATTGAAAGAGAGTAAAT
AAATATACTTTGTATTTATTATTCCTTATTAAAGTTTCTTTTTTAATTTAATTTATTTTA
GAATCTAAGCTGTGCATAAATTTGCAAAGGACATCTTCTTAAAGAGATTAGCTGAATTGC
AAGATATTGTTATCAATCCTATTGATTATGCAAAATGTGTCAAGTTAATTAAAAATGAAT
CGGATATCATGAAATTAGATTTTTCTAGCATTCCTACATTAACTATGCAGTAAATTACTT
CTATTTCTGTTGCAGCTTCGCAAGAAGAAGGAAAGTATTTAAATGCTAGCGAATACAAAT
AAGTCATAGCTGCTTGTGACAATATTTTAGAACTTCACGAGATGTCATTATAAGTAATTA
ATTTTTCATATTTATTATATATTTTATTTATCATAAAAATATATTTTAATTAGATATAAG
CTTACATAGAGAGTCGTATGAAATTTATTGCTCCAAATTTAAGTGCTCTCGTAGGAAGTA
CTTGTGCTTCTCGTTTGGTTACAGCAGCTGGTGGTGTGGAAGCTCTCTAAAGAATGCCTG
CTTGCAATATCTAAGTTATGGGTTCCTAGAAAAAATCACTGTTAGGTATGTCTAAAGAAG
GATAAGGAAATAACAGAGGTTATTTCGCATAATTAGAAATGGTCTAAAAAGCTCCTCCCT
AGTTTTAGACAAAACTAGTCAGAATGCTTTCTACTAATGTTGCAAAAGCTGTTCGTATTG
ATTTCTTGAAGACATGTCCTAGTGGATCTGCTGGAAAAAGATTGTATGATTTAATGATTT
AAAGATTCTCAAAAGTCTAAGAACCTCCTCCAGCCAAGATGAACAAACCTTTAGCTAAAC
CTGATGACAAGCCCAGCAGAAAAAGAGGTGGTGAGAAATATAGAAAGATTAAAGAGCGTT
TAGGATTAACTAATTTGAGAGCTTTATCACAAAGAATGATGTTTGGTGATTAAGTAATTT
TGAAAAAATTGATAAAAACTTAAATATTCTAAATAATTTATTAATTAAATTAAATAAAAG
GCAGAAGAAGAATTTAGAGACACAGGAAAGGGCTTTGGTCTATTGGGAGTTTAAGCTGGT
ACTATTAAGGTCAATGTAAGCAAGAGGAAGATTAAATTAAGTAATGTTATTAAATTTTAT
TTATATATTCTAAATTTAATATAAAAATAGCTCAAAAGCAATAAAAGCAGCAAGCTAAAT
AAGAATAAAGATAGGTTCCACTTAAAATAGCTGGCGGAGATATGCAAGATGGTCTTGCAT
CTAGCTTATAATTTACTTCAAATTAGGGAATAGAACTTATAAGTAAATAATAACTTTTTA
AGATAAATCTCTATTTAAATTTATTTGTAAAAATAAAGATCCTTACCTTCTCAAGCAAGA
TGGTATCAAGACAGAAAATTATTTTAACAAAGATGTTGGTTTCAGAACTGTTGTAGAAAC
AAAAAACAATGTAGGCTTACTCCCAGGTCAATTTAAGGCTCCTAATTGAGTTTACTACTT
AATCTATCTTAAAATTTAAATGTTGGTTGTGTTTGTTTTTAAACTTGTTTTTCATAAAAA
TTATCTTTAAATTTGCAATAAAAGTTGTTTAAAATTTTTAAAAAAATAATTAGGGTGTTT
TTTTTGTTTTAAACAGTAAAAATTAGTAAAAAAATTAATTTTTGCTAAAATTTACTCAAA
AAAATTTAGTTTGA