Identifiers and Description

Gene Model Identifier

TTHERM_00599960

Standard Name

PRP3 (pre-mRNA processing factor 3)

Aliases

PreTt22062 | 83.m00131 | 3685.m00023

Description

U4/U6 small nuclear ribonucleoprotein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02524 ) KID repeat
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF08572 ) pre-mRNA processing factor 3 (PRP3)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00599960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14870.19.997093137033517e-262hypothetical protein (823 aa)
OxytrichaContig413.1.g1008.000204209547377e-76pre-mRNA processing factor 3 (
PRP3)
WormBaseWBGene000108443.000458792073453e-56locus:prp-3 status:Confirmed
UniProt:Q21486 protein_id
:CAA88957.1
DictyBaseDDB_G02742134.9985000769285e-31prpf3 on chromosome: 2 positio
n 4766016 to 4767731
SGDYDR473C3.999672240330216e-26PRP3 Splicing factor, componen
t of the U4/U6-U5 snRNP comple
x
Stentor CoeruleusSteCoe_90815.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00599960(coding)
ATGAGTAAGAGGCCAGGAGAAGAAATTTAAGGGAATGATCCTTAAAAAAAAATAAAAACT
GCAGATCTTCCTACAGCTCCAAGTACAGCAAATAAAATATCTTATGGCAGTCTTAAACCT
CCAACATCTAGCAGTTCTTCTATATCTTATGCTGCTTTTAAAAAATAATAATTATCTACT
ATGAAATAGCCTGCTAAACCAATTAGCCAATAATAGGTTCCTTAATCTACAGGATCTAGT
TTGACATCTGCTGCAGCAGCTGTATAAAATAATTAAAATGCTTCAAAATAATTAACATAA
TAGGGTAGTTCATAAGCTTAAGATAGTAAAATAATTGATGCCGCATCTTCAAATTAAAAA
AATCAAGATTCTAATGCATCAAATAAAAATGAAAATAAAAACACTTCTGAACAATCTTAA
AATAAATTTAGTGAAGCTTAACCTAACCCATAATAAGTAGCACCTAAAACAATTGATTTA
AAAAGCTAGTAATAATAAATCATAGAAAGAGCTAAGAAGTTAAGAGAAGAAGAAAAAAGA
CTTGCTGAATTAAAAAAGAATACAGCTGTCATTTAAAAAGTCTAAAATGCTTAATAAGGA
ATAAAACCTGGCTAACCAAGTTCTATAAGTCAAACAAAAATTCAAAAAGAATTAAAGAAG
AAAGAGGAAAAGAAACCTCTTACAAAATAAGAATTAGAAATGAAATAACTTTAGGAATTT
GCTAAGAAAAAGGAAAAAGAATAAAAATTAATTGAAAAATTGCTGAAAGAAGGCAAAATA
AAGCCAGAAGATTTAGATAAATCAAGCAAGAAGGAAGAGATAAAAATTGACAGCAAAGAA
AAAGAAGTACGTTTAGATGAAAAAGGTAATTTAATCGATATTAAGGGTAACATAATTGTA
ATTGACTCAAATAAAAGCACCTTAAAAATCAATTAACAAAAGAAGCAACTAGATAAATTA
ACTAAAATGGCTAGAAATGCTCGTTTTTAAAACTCACAAGTATTTTAAGATTCTAGCATA
TTTACTACAACAAGTTTAAAGAGAGAAAGGAAGAAAATGCATGCACTTAACTTTATAGAA
GATACAAATTAAATTGAAGACGAAAAAGAAGAATATGAAGATAAAATGGATATTGAGAGT
AAGAGTGAAGAAGATTAATCTGGTTCTAGTTCAAGTGAAAGTGAGACTGAACAAAAAATG
GAATAAGAAAACCAATAAAATGAAGAAAATATAGAAAAAAATGAAGATTTCAGATAATTG
ATTCAAAAAACTGAAACTGATTACAGAAGAGAAGATTTTTAGAAAACAAATAGCAAATAT
TTACAAAGTTTACACAAAAAAAAGTAGAGTTTGAAGCAAAAGCATCACGATCCTATTCCA
GATATTGAATGGTGGGATTTGGCATTATTCGATAATACTAGAAGATACTACTTACCATTA
GACCAAGCTAACTAAACAATTGCTAATTAAGCAATTCAAGCAGGAAACGAATCTAATGCT
ACAACTAATAACAATCCTGAAAATTAAACAGCCAACGAAAATAATTTGTCAATTAACATT
TTGGATAATTTAGAGATTATTAAGCAATTATTGTCTAAATTATAAGTTGAAAATTTCGAA
TACTCTAAGGATTATTATCGTTAAGAAAAAATTACTAACTTGATAGAGCATCCTAAGCCT
TTTAAAAATGATGGATTGCCTAATTCTAATCAACTCGTAGTCATTCCTAACTACTTAACT
AAGAAAGAGTAAAAAAAGCTGAGCAGACGTCATCGTTTAGAAAAAGAAAAAGAAAAGCAA
GATAAAATAAAATTAGGATTAATCAAGCCTCCTCCTCCTAAAGTTAGACTAAAAAATATG
ATGCGTGTTTTAGGTAATGAAGCAGTTGCTGATCCTACAAAAATGGAAGCTTTGGTTAGA
TAAGGCATAGCTGAGCGTTTGTAGGAGCATCTTCGTAGAAATTAAGAACGTTAATTGACT
AAAGAGCAAAAAGCTGAGAAATTCTTACGTAAGCTTAAAAGAGATAGTGCTATTGAATGT
AGAGTAGCCCTATTCAGAATTGAAAATCTATAAGACAGAGTTCATAAGTTTAAGGTTGAC
ATCAATGCATAATAAATGTAATTGCATGGTGCTCTTATTAACCCAGTAGAAAATCCTGAA
AGTAGATCTACTATAAATATGCCTGCAATAGTCCTCGTTGAAGGTGGTCCCAAGGCAATT
AAGTTTTATAAAAAGCTTATGCTTCGTCGTATTAAATGGAACAAAAACAGCTACTTACCT
AAAGATGAAAATGGTGAAATTATTACTCCAGTTGACTTGACAGATAATAAATGTGCTTTA
GTTTGGGAAGGAGTAGTTAAAGATCACAATTTCAATAAATGGAAAGTTCATGATGTGGAC
AGTGAAGTAGAAGCTAGAAGAGTTTTTACAGAAAAAAATGTAGAGTTTTACTTTGACATG
GCAATTAACTATTAATATCCTAATTGA


>TTHERM_00599960(protein)
MSKRPGEEIQGNDPQKKIKTADLPTAPSTANKISYGSLKPPTSSSSSISYAAFKKQQLST
MKQPAKPISQQQVPQSTGSSLTSAAAAVQNNQNASKQLTQQGSSQAQDSKIIDAASSNQK
NQDSNASNKNENKNTSEQSQNKFSEAQPNPQQVAPKTIDLKSQQQQIIERAKKLREEEKR
LAELKKNTAVIQKVQNAQQGIKPGQPSSISQTKIQKELKKKEEKKPLTKQELEMKQLQEF
AKKKEKEQKLIEKLLKEGKIKPEDLDKSSKKEEIKIDSKEKEVRLDEKGNLIDIKGNIIV
IDSNKSTLKINQQKKQLDKLTKMARNARFQNSQVFQDSSIFTTTSLKRERKKMHALNFIE
DTNQIEDEKEEYEDKMDIESKSEEDQSGSSSSESETEQKMEQENQQNEENIEKNEDFRQL
IQKTETDYRREDFQKTNSKYLQSLHKKKQSLKQKHHDPIPDIEWWDLALFDNTRRYYLPL
DQANQTIANQAIQAGNESNATTNNNPENQTANENNLSINILDNLEIIKQLLSKLQVENFE
YSKDYYRQEKITNLIEHPKPFKNDGLPNSNQLVVIPNYLTKKEQKKLSRRHRLEKEKEKQ
DKIKLGLIKPPPPKVRLKNMMRVLGNEAVADPTKMEALVRQGIAERLQEHLRRNQERQLT
KEQKAEKFLRKLKRDSAIECRVALFRIENLQDRVHKFKVDINAQQMQLHGALINPVENPE
SRSTINMPAIVLVEGGPKAIKFYKKLMLRRIKWNKNSYLPKDENGEIITPVDLTDNKCAL
VWEGVVKDHNFNKWKVHDVDSEVEARRVFTEKNVEFYFDMAINYQYPN


>TTHERM_00599960(gene)
ATGAGTAAGAGGCCAGGAGAAGAAATTTAAGGGAATGATCCTTAAAAAAAAATAAAAACT
GCAGATCTTCCTACAGCTCCAAGTACAGCAAATAAAATATCTTATGGCAGTCTTAAACCT
CCAACATCTAGCAGTTCTTCTATATCTTATGCTGCTTTTAAAAAATAATAATTATCTACT
ATGAAATAGCCTGCTAAACCAATTAGCCAATAATAGGTTCCTTAATCTACAGGATCTAGT
TTGACATCTGCTGCAGCAGCTGTATAAAATAATTAAAATGCTTCAAAATAATTAACATAA
TAGGGTAGTTCATAAGCTTAAGATAGTAAAATAATTGATGCCGCATCTTCAAATTAAAAA
AATCAAGATTCTAATGCATCAAATAAAAATGAAAATAAAAACACTTCTGAACAATCTTAA
AATAAATTTAGTGAAGCTTAACCTAACCCATAATAAGTAGCACCTAAAACAATTGATTTA
AAAAGCTAGTAATAATAAATCATAGAAAGAGCTAAGAAGTTAAGAGAAGAAGAAAAAAGA
CTTGCTGAATTAAAAAAGAATACAGCTGTCATTTAAAAAGTCTAAAATGCTTAATAAGGA
ATAAAACCTGGCTAACCAAGTTCTATAAGTCAAACAAAAATTCAAAAAGAATTAAAGAAG
AAAGAGGAAAAGAAACCTCTTACAAAATAAGAATTAGAAATGAAATAACTTTAGGAATTT
GCTAAGAAAAAGGAAAAAGAATAAAAATTAATTGAAAAATTGCTGAAAGAAGGCAAAATA
AAGCCAGAAGATTTAGATAAATCAAGCAAGAAGGAAGAGATAAAAATTGACAGCAAAGAA
AAAGAAGTACGTTTAGATGAAAAAGGTAATTTAATCGATATTAAGGGTAACATAATTGTA
ATTGACTCAAATAAAAGCACCTTAAAAATCAATTAACAAAAGAAGCAACTAGATAAATTA
ACTAAAATGGCTAGAAATGCTCGTTTTTAAAAGTAAATTTTATTAAATTTTATAAACCTT
TATTAAATATTTTATAATTTTAAAAAGCTCACAAGTATTTTAAGATTCTAGCATATTTAC
TACAACAAGTTTAAAGAGAGAAAGGAAGAAAATGCATGCACTTAACTTTATAGAAGATAC
AAATTAAATTGAAGACGAAAAAGAAGAATATGAAGATAAAATGGATATTGAGAGTAAGAG
TGAAGAAGATTAATCTGGTTCTAGTTCAAGTGAAAGTGAGACTGAACAAAAAATGGAATA
AGAAAACCAATAAAATGAAGAAAATATAGAAAAAAATGAAGATTTCAGATAATTGATTCA
AAAAACTGAAACTGATTACAGAAGAGAAGATTTTTAGAAAACAAATAGCAAATATTTACA
AAGTTTACACAAAAAAAAGTAGAGTTTGAAGCAAAAGCATCACGATCCTATTCCAGATAT
TGAATGGTGGGATTTGGCATTATTCGATAATACTAGAAGATACTACTTACCATTAGACCA
AGCTAACTAAACAATTGCTAATTAAGCAATTCAAGCAGGAAACGAATCTAATGCTACAAC
TAATAACAATCCTGAAAATTAAACAGCCAACGAAAATAATTTGTCAATTAACATTTTGGA
TAATTTAGAGATTATTAAGCAATTATTGTCTAAATTATAAGTTGAAAATTTCGAATACTC
TAAGGATTATTATCGTTAAGAAAAAATTACTAACTTGATAGAGCATCCTAAGCCTTTTAA
AAATGATGGATTGCCTAATTCTAATCAACTCGTAGTCATTCCTAACTACTTAACTAAGAA
AGAGTAAAAAAAGCTGAGCAGACGTCATCGTTTAGAAAAAGAAAAAGAAAAGCAAGATAA
AATAAAATTAGGATTAATCAAGCCTCCTCCTCCTAAAGTTAGACTAAAAAATATGATGCG
TGTTTTAGGTAATGAAGCAGTTGCTGATCCTACAAAAATGGAAGCTTTGGTTAGATAAGG
CATAGCTGAGCGTTTGTAGGAGCATCTTCGTAGAAATTAAGAACGTTAATTGACTAAAGA
GCAAAAAGCTGAGAAATTCTTACGTAAGCTTAAAAGAGATAGTGCTATTGAATGTAGAGT
AGCCCTATTCAGAATTGAAAATCTATAAGACAGAGTTCATAAGTTTAAGGTTGACATCAA
TGCATAATAAATGTAATTGCATGGTGCTCTTATTAACCCAGTAGAAAATCCTGAAAGTAG
ATCTACTATAAATATGCCTGCAATAGTCCTCGTTGAAGGTGGTCCCAAGGCAATTAAGTT
TTATAAAAAGCTTATGCTTCGTCGTATTAAATGGAACAAAAACAGCTACTTACCTAAAGA
TGAAAATGGTGAAATTATTACTCCAGTTGACTTGACAGATAATAAATGTGCTTTAGTTTG
GGAAGGAGTAGTTAAAGATCACAATTTCAATAAATGGAAAGTTCATGATGTGGACAGTGA
AGTAGAAGCTAGAAGAGTTTTTACAGAAAAAAATGTAGAGTTTTACTTTGACATGGCAAT
TAACTATTAATATCCTAATTGA