Identifiers and Description

Gene Model Identifier

TTHERM_00525150

Standard Name

PRP2 (Pre-mRNA Processing factor 2)

Aliases

PreTt06352 | 66.m00151 | 3722.m00010

Description

U2 snRNP auxilliary factor; splicing factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01622 ) splicing factor, CC1-like family
  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( TIGR01642 ) U2 snRNP auxilliary factor, large

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00525150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13363.19.997093137033517e-262U2 snRNP auxilliary factor, sp
licing factor (473 aa)
OxytrichaContig20715.0.g173.000458792073453e-56RNA recognition motif_ (a_k_a_
RRM, RBD, or RNP domain)
WormBaseWBGene000066976.000354955737408e-39locus:uaf-1 status:Confirmed
UniProt:Q8MXS2 protein_id
:CCD62281.1
DictyBaseDDB_G02863954.998978211117678e-38u2af2 on chromosome: 4 positio
n 4405482 to 4407497
Stentor CoeruleusSteCoe_42284.780892883885469e-25
SGDYIR005W0.0005997485943342685IST3 Component of the U2 snRNP
, required for the first catal
ytic step of splicing and for
spliceosomal assembly; interac
ts with Rds3p and is required
for Mer1p-activated splicing

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00525150(coding)
ATGGATATCGAAATTAATTAACTATAATATAATAATCAATAAGGAGAGGAGTTTAAGTAA
GCTGAAGAATAAATAATTGAATAGGATCATAGAAAATATTCTAGTGATGAAGAAGAGGAA
GATGATGAAGATATCATATAAAAATAAAAAAACGAATCTATCAAAGATGAGAATACTACA
TAAATAAGCAATTAAGATGGAGGAGATGGCTAAAAATAAAAGAAGAAGAAGAAAAAGAAA
AGAAAAAGAGACTTACCTGAAGAGGAGGAAACTGATTATGAAGTAGATATTGTCAAAAAA
GCTAAAACATCAAAATTATTACTTTGTGAAGCAATTCAAGATCATTTAAGATAAAGATAT
GCATTAATAGAAGCCAACCCTTGGTTATTAATTGTATCTGATATACCAAGAATGATTACA
GATATTGAAATTAAGGAGTTCTTCAATATTCTAATTTCTAAATTAAGACCAGAACTAGCT
GAACCCTCACCTGTTGTAAAAGTAGATGTTATGACCAATGGATAATTTGCTACTATGCAT
ATGAGTTGTAAATTGGCCAAAAGCTTTGCTCTTACTTTAAGGGGTGTTGAATTCTAAAAA
TGCAAATTGATGATAGAAAAACCCAAGCAATACTTTTTTAGGATGTATATGGAGAAATAA
TAAAATGATGATGTTATGGTAGATGTAGATGATGGTGCTTTGTAGCAAATGCAAATGAAT
AAAATTTATATGGGTGGTTTGCCTACTTATTTAAAAGACATAGATGTTAGAAAATTATGT
GAAACCTTTGGCAAATTAAAATACTTTAATGTAGCAAAACAATAAAATGAAAATAAAGAG
CAAGTTTCTAAAGGTTACTGTTTTTTTGAATACGAAGATCCAAATATCACTGAGAAAGCT
ATTAAAGCACTTAATGGTCTACCTTGTGGTGATAGAAAGTTAAAAGTTTCTAGAGTCACA
AAAGATCAAAATAAACTTGCAAATACACAATAAATTTAAAGTGAAAAAAACAAATTAGCT
CCTTCTAATAATAGTGGTAGTTTTCTAGGAGGTTCTGATTTAATTAGAAAAGACGAATTT
TAAAAGTTATTAACTATTCCGGAATTTACTTCTCTTCCAAGTAGAGTTATTCAATTATTA
AATATGGTGTCAATTGAAGATCTATTTGAAGATGACATTGTAGATGATTTATATTAAGAT
GTTATGACAGAATGCGAGAAAATAGGACCAGTTGAGAAAATAGAAATCCCAAAGCCATGC
AAAACTACAGGCATATGCCCTCCATGCATAGGAAAAGTTTTTGTTAAATTTAAATATATG
TTGAAGGCAAAGAAGGCAAGATATAGTTTGAATGGAAGAACATATAATCGTAGAACAGTA
ATAGCTTCATTTTATCCTGAGGATAAGTTTGATCGCAAAGATTTTCTTGTTTCTATTTTG
TGA


>TTHERM_00525150(protein)
MDIEINQLQYNNQQGEEFKQAEEQIIEQDHRKYSSDEEEEDDEDIIQKQKNESIKDENTT
QISNQDGGDGQKQKKKKKKKRKRDLPEEEETDYEVDIVKKAKTSKLLLCEAIQDHLRQRY
ALIEANPWLLIVSDIPRMITDIEIKEFFNILISKLRPELAEPSPVVKVDVMTNGQFATMH
MSCKLAKSFALTLRGVEFQKCKLMIEKPKQYFFRMYMEKQQNDDVMVDVDDGALQQMQMN
KIYMGGLPTYLKDIDVRKLCETFGKLKYFNVAKQQNENKEQVSKGYCFFEYEDPNITEKA
IKALNGLPCGDRKLKVSRVTKDQNKLANTQQIQSEKNKLAPSNNSGSFLGGSDLIRKDEF
QKLLTIPEFTSLPSRVIQLLNMVSIEDLFEDDIVDDLYQDVMTECEKIGPVEKIEIPKPC
KTTGICPPCIGKVFVKFKYMLKAKKARYSLNGRTYNRRTVIASFYPEDKFDRKDFLVSIL


>TTHERM_00525150(gene)
ATGGATATCGAAATTAATTAACTATAATATAATAATCAATAAGGAGAGGAGTTTAAGTAA
GCTGAAGAATAAATAATTGAATAGGATCATAGAAAATATTCTAGTGATGAAGAAGAGGAA
GATGATGAAGATATCATATAAAAATAAAAAAACGAATCTATCAAAGATGAGAATACTACA
TAAATAAGCAATTAAGATGGAGGAGATGGCTAAAAATAAAAGAAGAAGAAGAAAAAGAAA
AGAAAAAGAGACTTACCTGAAGAGGAGGAAACTGATTATGAAGTAGATATTGTCAAAAAA
GCTAAAACATCAAAATTATTACTTTGTGAAGCAATTCAAGATCATTTAAGATAAAGATAT
GCATTAATAGAAGCCAACCCTTGGTTATTAATTGTATCTGATATACCAAGAATGATTACA
GATATTGAAATTAAGGAGTTCTTCAATATTCTAATTTCTAAATTAAGACCAGAACTAGCT
GAACCCTCACCTGTTGTAAAAGTAGATGTTATGACCAATGGATAATTTGCTACTATGCAT
ATGAGTTGTAAATTGGCCAAAAGCTTTGCTCTTACTTTAAGGGGTGTTGAATTCTAAAAA
TGCGTAAAAATTATGATTAAAAGAAAATTTTAGAAATAAAAGAGAGAATTTATAATAAAA
TCAAGCAAAAATAAATCTTTTCAATAAAAAATATTTTTTCAAATCTAAAAAAGTGATAGA
AACACATAAATTTATAATTATAATTAATTTTATAAATAACTTCTTTTAGTTAAAAATATT
AGCTTGATTTTGTTAACTTTTTCTTCAAAAAATCTACATTTTCTTTTGAAAATGATATTA
TTTTCAAGATAAAGATTGAAATTTATTTTTAAAACATTTATTTAATTTCATATATTTTTT
ATAATATAGAAATTGATGATAGAAAAACCCAAGCAATACTTTTTTAGGATGTATATGGAG
AAATAATAAAATGATGATGTTATGGTAGATGTAGATGATGGTGCTTTGTAGCAAATGCAA
ATGAATAAAATTTATATGGGTGGTTTGCCTACTTATTTAAAAGACATAGATGTTAGAAAA
TTATGTGAAACCTTTGGCAAATTAAAATACTTTAATGTAGCAAAACAATAAAATGAAAAT
AAAGAGCAAGTTTCTAAAGGTTACTGTTTTTTTGAATACGAAGATCCAAATATCACTGAG
AAAGCTATTAAAGCACTTAATGGTCTACCTTGTGGTGATAGAAAGTTAAAAGTTTCTAGA
GTCACAAAAGATCAAAATAAACTTGCAAATACACAATAAATTTAAAGTGAAAAAAACAAA
TTAGCTCCTTCTAATAATGTAAATTGAATTCAAACATATTTTTTTATTTTAAAAACTCGT
ATAAAATAGAGTGGTAGTTTTCTAGGAGGTTCTGATTTAATTAGAAAAGACGAATTTTAA
AAGTTATTAACTATTCCGGAATTTACTTCTCTTCCAAGTAGAGTTATTCAATTATTAAAT
ATGGTGTCAATTGAAGATCTATTTGAAGATGACATTGTAGATGATTTATATTAAGATGTT
ATGACAGAATGCGAGAAAATAGGACCAGTTGAGAAAATAGAAATCCCAAAGCCATGCAAA
ACTACAGGCATATGCCCTCCATGCATAGGAAAAGTTTTTGTTAAATTTAAGTAAATTTTT
ATATCATTAAAATTATAAATTTCTAAATATCATTTGAGGTTTTTAAAGGAAATTTCTAAG
AACTTTTTATAAATAAAAAATTAAAATATATTTTTTATTTACAAAGATATATGTTGAAGG
CAAAGAAGGCAAGATATAGTTTGAATGGAAGAACATATAATCGTAGAACAGTAATAGCTT
CATTTTATCCTGAGGATAAGTTTGATCGCAAAGATTTTCTTGTTTCTATTTTGTGA