Identifiers and Description

Gene Model Identifier

TTHERM_00161050

Standard Name

PRP19 (pre-mRNA-splicing factor 19)

Aliases

PreTt28497 | 13.m00456 | 3829.m01318

Description

pre-mRNA-splicing factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00161050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05362.19.997093137033517e-262hypothetical protein (509 aa)
WormBaseWBGene000204232.998830401637127e-79locus:prp-19 Pre-mRNA-proces
sing factor 19 homolog statu
s:Confirmed UniProt:Q10051
protein_id:CCD72869.1
DictyBaseDDB_G02768036.001182358613152e-70prp19 on chromosome: 2 positio
n 7360384 to 7362414
OxytrichaContig22546.0.g711.0002012508493003e-67Prp19/Pso4-like
SGDYLL036C8.000124778438792e-23PRP19 Splicing factor associat
ed with the spliceosome; conta
ins a U-box, a motif found in
a class of ubiquitin ligases,
and a WD40 domain
Stentor CoeruleusSteCoe_183047.781132241133797e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00161050(coding)
ATGTCTTGGAATTATTGTGCTATAACTGGAGAATAGCTTCATGAACCCGTAGTTTCAAAA
AAGAGCGGTCATGTTTTTGAAAAAAGAGTTATTGAAAAACATATTTAATCAACTGGTTAA
TGCCCAATTACTGGCTAAGCCTTAAGCAACGATGATTTGATTCCAGTTTAATTAAATGTC
TAAACTAAACCTAGATCTGTCACTTCAAATTCTATTCCTGGAATATTAAAAACATTTTAG
AACGAATGGGATGCATTAATGCTCGAAACTTATAATTTAAAATAACATTTGGAAACAGTT
CGTTAAGAGCTCTCCCATGCTCTTTACTAGCATGATGCTGCCTGTAGAGTTATTGCTCGT
TTGATCAAAGAAAGAGATGAAGCTAGATTTGAAGTTGCCTAGCTTTAAGAAAAGTTAAGA
TAAGGTAAAATGGAATTAGAAGAAGCAGATGCTTAAAATGAATAATAACAAGAGCAAACA
AACAATAAGCTTCCTTAAAATATTATTGATTCAATTAATGAAACAGCTTTAAAGTTAAAC
TAAATAAGAAAAGATAGAAAGAAAGATGCTGAATACAATAGCAAGTTTGCAGCTACTGAG
GTCATTTCGAGCTATGGTCCTAAGGAAACTGTTGGCTTACATAGTACTACAAACCCTGGA
ATTAATGCTTTAGATTATAATCGTTAGAGAAATTTAGTTATTAGTGGTGGTAAAGACGGA
TCTGTTATCCTTTACAATACTGTTTAAAATGTTATTGAAGGAACAGTGGAATTAAATAAA
CATATTGTTGCCTTGACATTTTTAGGAAACGATGAAAATCCCCACTTTGTTGCTGTTACT
GAACACGCAGCTCATCTCTACTAATTCTAAGCTGAAAATAAATAATTTAATAGTTTATAT
ACCTACAACACTAATTCTTCATTTACCTCTGTTTCTGCTCATCCTAACGGATCTCTATTC
GTACTTTCTGCCAAAGACGGTTCAGTAACATACCATGATGCAATTTCTGCTTCTCTCGTT
TTAGAAGTTAATGATTTAGTTGGAAAGCTCAGTGTTAACAGTATTTAAGTACATCCTGAT
GGTAACCTTCTTGGTATCGGATGTAGTGATGGCTCAGTTAAATTGTGGAATATATCTTCT
AACGAAATAATGACATCTTTGGAAGACAATGTCAATGGAGCAATAGACTTGATCAGTTTT
AGTGAAAACGGTTATATTTTATCAGTAGGTAGTACAGTTAGTAAAGTAGTAAAGATCTAC
GATTTAAGAAAAGCTAAGTGCATTAAAACTTTGTTTGGTGAAGGAGATGAATTTTCTTTG
TCAAGCATTGAATTTGACCTTTCTGGTAATGTATTTGCTGCTGGTTCTACTACAGGATAA
ATAAAACTCTACGAAACTAAGAAATGGAACCACCTTTCAACATTCTCTTATCATACAGCT
GCCGTTAAATCTTTGAAGTTTGGTAATTTCTCAAAAGAATTAGTTTCTGGTTCTTTGGAT
AGAAATTTAATTATTTCTTCGTAATGA


>TTHERM_00161050(protein)
MSWNYCAITGEQLHEPVVSKKSGHVFEKRVIEKHIQSTGQCPITGQALSNDDLIPVQLNV
QTKPRSVTSNSIPGILKTFQNEWDALMLETYNLKQHLETVRQELSHALYQHDAACRVIAR
LIKERDEARFEVAQLQEKLRQGKMELEEADAQNEQQQEQTNNKLPQNIIDSINETALKLN
QIRKDRKKDAEYNSKFAATEVISSYGPKETVGLHSTTNPGINALDYNRQRNLVISGGKDG
SVILYNTVQNVIEGTVELNKHIVALTFLGNDENPHFVAVTEHAAHLYQFQAENKQFNSLY
TYNTNSSFTSVSAHPNGSLFVLSAKDGSVTYHDAISASLVLEVNDLVGKLSVNSIQVHPD
GNLLGIGCSDGSVKLWNISSNEIMTSLEDNVNGAIDLISFSENGYILSVGSTVSKVVKIY
DLRKAKCIKTLFGEGDEFSLSSIEFDLSGNVFAAGSTTGQIKLYETKKWNHLSTFSYHTA
AVKSLKFGNFSKELVSGSLDRNLIISSQ


>TTHERM_00161050(gene)
ATGTCTTGGAATTATTGTGCTATAACTGGAGAATAGCTTCATGAACCCGTAGTTTCAAAA
AAGAGCGGTCATGTTTTTGAAAAAAGAGTTATTGAAAAACATATTTAATCAACTGGTTAA
TGCCCAATTACTGGCTAAGCCTTAAGCAACGATGATTTGATTCCAGTTTAATGTAATTAT
TTATCAATAGTCTAGCTTAATTTACAATTAAAATATATAGCATAAGTTTACAATTTTGAT
TCTTTCAATCAAGTTGAAAAGAAGACATTTATATTATCAATTTGATATAATTTTGCATTT
ATAATAAATTTATTATTAATAAAAAAATTAGTAAATGTCTAAACTAAACCTAGATCTGTC
ACTTCAAATTCTATTCCTGGAATATTAAAAACATTTTAGAACGAATGGGATGCATTAATG
CTCGAAACTTATAATTTAAAATAACATTTGGAAACAGTTCGTTAAGAGCTCTCCCATGCT
CTTTACTAGCATGATGCTGCCTGTAGAGTTATTGCTCGTTTGATCAAAGAAAGAGATGAA
GCTAGATTGTAAACAAACAAATATATTATTATTATTTCTCAATTAAACATTTAAGTGAAG
ATCTGCTTAAATATCAAAACAATAGAATTTAAATTTATTTTAATAAGCCTTGAAGCTATT
GTGGATTAATATTAATTTATTTTTATTCAAAATTAGTGAAGTTGCCTAGCTTTAAGAAAA
GTTAAGATAAGGTAAAATGGAATTAGAAGAAGCAGATGCTTAAAATGAATAATAACAAGA
GCAAACAAACAATAAGCTTCCTTAAAATATTATTGATTCAATTAATGAAACAGCTTTAAA
GTTAAACTAAATAAGAAAAGATAGAAAGAAAGATGCTGAATACAATAGCAAGTTTGCAGC
TACTGAGGTAAATAATATATACATATATGATATGAATTTAGCTTTTATAGCTTGAAATAT
AGATTAATGTTTTCTAATAAATGTAAATTTTAGGTCATTTCGAGCTATGGTCCTAAGGAA
ACTGTTGGCTTACATAGTACTACAAACCCTGGAATTAATGCTTTAGATTATAATCGTTAG
AGAAATTTAGTTATTAGTGGTGGTAAAGACGGATCTGTTATCCTTTACAATACTGTTTAA
AATGTTATTGAAGGAACAGTGGAATTAAATAAACATATTGTTGCCTTGACATTTTTAGGA
AACGATGAAAATCCCCACTTTGTTGCTGTTACTGAACACGCAGCTCATCTCTACTAATTC
TAAGCTGAAAATAAATAATTTAATAGTTTATATACCTACAACACTAATTCTTCATTTACC
TCTGTTTCTGCTCATCCTAACGGATCTCTATTCGTACTTTCTGCCAAAGACGGTTCAGTA
ACATACCATGATGCAATTTCTGTAAAATTTTAAATGAGATAATTTTTTACTAATTTTAAA
TGTAAATATCAAATAGGCTTCTCTCGTTTTAGAAGTTAATGATTTAGTTGGAAAGCTCAG
TGTTAACAGTATTTAAGTACATCCTGATGGTAACCTTCTTGGTATCGGATGTAGTGATGG
CTCAGTTAAATTGTGGAATATATCTTCTAACGAAATAATGACATCTTTGGAAGACAATGT
CAATGTATAAAAATTTTTAAATAGTATTATTGTATTAAATTATTCTTAAAAATTGAAATA
GGGAGCAATAGACTTGATCAGTTTTAGTGAAAACGGTTATATTTTATCAGTAGGTAGTAC
AGTTAGTAAAGTAGTAAAGATCTACGATTTAAGAAAAGCTAAGTGCATTAAAACTTTGTT
TGGTGAAGGAGATGAATTTTCTTTGTCAAGCATTGAATTTGACCTTTCTGGTAATGTATT
TGCTGCTGGTTCTACTACAGGATAAATAAAACTCTACGAAACTAAGAAATGGAACCACCT
TTCAACATTCTCTTATCATACAGCTGCCGTTAAATCTTTGAAGTAAAATACTTGTTTATC
AAAAAAATTTAAATTAATTAATTGTTATTAATGTATTAAAGGTTTGGTAATTTCTCAAAA
GAATTAGTTTCTGGTTCTTTGGATAGAAATTTAATTATTTCTTCGTAATGA