Identifiers and Description

Gene Model Identifier

TTHERM_00637170

Standard Name

PRP18 (pre-mRNA-splicing factor PRP18)

Aliases

PreTt19720 | 91.m00135

Description

pre-mRNA-splicing factor

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF02840 ) Prp18 domain
  • ( PF00123 ) Peptide hormone
  • ( PF04081 ) DNA polymerase delta, subunit 4
  • ( PF08799 ) pre-mRNA processing factor 4 (PRP4)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00637170

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03535.19.997093137033517e-262Prp18 domain-containing protei
n (375 aa)
DictyBaseDDB_G02745551.0000099287337047e-53prp18 on chromosome: 2 positio
n 4164827 to 4165996
OxytrichaContig7183.0.g741.9998745702418095e-48Prp18 domain
WormBaseWBGene000093201.9994920269952867e-34status:Confirmed UniProt:O45
431 protein_id:CAB03039.2
SGDYGR006W0.0000000000000030004923591262316PRP18 Splicing factor involved
in the positioning of the 3 s
plice site during the second c
atalytic step of splicing, par
t of snRNP U5, interacts with
Slu7p
Stentor CoeruleusSteCoe_331480.000045399929762484854

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00637170(coding)
ATGGATTCTTTGAAAAATATTTTAGCAAAAAAAAAGGAAACGGTTTAAAAGCAAGGATAG
GTTGTTAAAAAAGCTGACTTAGAAAAGGAAAGAGAAGAGAATTACTGGAAATAATAGGCT
GAAATACAAAAATAGGAAGAATTAAGAAAATAATAATATTTGGAAGATTTGCAAAAATAT
TAAGCTAATCCTTACAAAAAATTAAAGAAAGATGAAAAAAAGGATGAAGGTTAGTAAAAT
GAAAACAAAGAAGAAGAATAGCCTCCTATACCTAAAGCAGAAGTCATTAAAAAATTGAGA
TAATTTGGAGTTCCTGTAACTTTTTTTGGTGAAACTGATTAACAAAGATACAAAAGATTA
AAAAAACTAGAACTTGATGCTACTGAAAATAAAAATTAGGGTGGTAACGTCTATGATAAA
ATTTTAAAAATGAATGAGGAAGACTTCAAAAAGAAATAAAGAGAGGAAGCTGATTATATT
GATGAAGAAAAAATTTAAAAACTTTTTGCAAGGTTAAACTAACCAGAATAAAATATTAGT
ACTGAAAAGGTAACTAATAAAAAGCAGTAAGAATTAGAAATAGAAAAACTTAAGCAAGTG
TCTAACGATACTAAAAATGAAGATATTTTAATATGGAGTTAAAAAACACTTCGTGATTGG
GAGTAGAAATTAGAATAGAGATTCACAACTGATGAATAGAAAAAATCTGTTTTAGCAAGA
AAATTAATTGGTAATTTCCGTCAAACATCAGAGTACTTGAAACCTTTGTTTAAGCTTTTA
AAAGAAAAGAAATGTAGTTAAGATATTCTAGATGGATTATACATAGTCGTAAATTATGCA
TTATAAAGGGAGTATGTAAAAGCAAATGACAAATATTTAGCCTTAGCTATTGGTAATGCT
GCTTGGCCTATGGGTGTCACAATGGTTGGTATCCACGAAAGAGCTGGTCGTTCCAAAATT
TTTAGTTCTTAAGTTGCACATATATTAAATGATGAAACAACCAGAAAGTATTTGTAATCA
ATGAAGAGACTTGTTACAGTTTAATAGCTTATGTATCCTTCTGAAGATAAAGCTAAGATG
ATAAATTATGACACAACAATGGAGGAGTTATTTTGA


>TTHERM_00637170(protein)
MDSLKNILAKKKETVQKQGQVVKKADLEKEREENYWKQQAEIQKQEELRKQQYLEDLQKY
QANPYKKLKKDEKKDEGQQNENKEEEQPPIPKAEVIKKLRQFGVPVTFFGETDQQRYKRL
KKLELDATENKNQGGNVYDKILKMNEEDFKKKQREEADYIDEEKIQKLFARLNQPEQNIS
TEKVTNKKQQELEIEKLKQVSNDTKNEDILIWSQKTLRDWEQKLEQRFTTDEQKKSVLAR
KLIGNFRQTSEYLKPLFKLLKEKKCSQDILDGLYIVVNYALQREYVKANDKYLALAIGNA
AWPMGVTMVGIHERAGRSKIFSSQVAHILNDETTRKYLQSMKRLVTVQQLMYPSEDKAKM
INYDTTMEELF


>TTHERM_00637170(gene)
ATGGATTCTTTGAAAAATATTTTAGCAAAAAAAAAGGAAACGGTTTAAAAGCAAGGATAG
GTTGTTAAAAAAGCTGACTTAGAAAAGGAAAGAGAAGAGAATTACTGGAAATAATAGGCT
GAAATACAAAAATAGGAAGAATTAAGAAAATAATAATATTTGGAAGATTTGCAAAAATAT
TAAGCTAATCCTTACAAAAAATTAAAGAAAGATGAAAAAAAGGATGAAGGTTAGTAAAAT
GAAAACAAAGAAGAAGAATAGCCTCCTATACCTAAAGCAGAAGTCATTAAAAAATTGAGA
TAATTTGGAGTTCCTGTAACTTTTTTTGGTGAAACTGATTAACAAAGATACAAAAGATTA
AAAAAACTAGAACTTGATGCTACTGAAAATAAAAATTAGGGTGGTAACGTCTATGATAAA
ATTTTAAAAATGAATGAGGAAGACTTCAAAAAGAAATAAAGAGAGGAAGCTGATTATATT
GATGAAGAAAAAATTTAAAAACTTTTTGCAAGGTTAAACTAACCAGAATAAAATATTAGT
ACTGAAAAGGTAACTAATAAAAAGCAGTAAGAATTAGAAATAGAAAAACTTAAGCAAGTG
TCTAACGATACTAAAAATGAAGATATTTTAATATGGAGTTAAAAAACACTTCGTGATTGG
GAGTAGAAATTAGAATAGAGATTCACAACTGATGAATAGAAAAAATCTGTTTTAGCAAGA
AAATTAATTGGTAATTTCCGTCAAACATCAGAGTACTTGAAACCTTTGTTTAAGCTTTTA
AAAGAAAAGAAATGTAGTTAAGATATTCTAGATGGATTATACATAGTCGTAAATTATGCA
TTATAAAGGGAGTATGTAAAAGCAAATGACAAATATTTAGCCTTAGCTATTGGTAATGCT
GCTTGGCCTATGGGTGTCACAATGGTTGGTATCCACGAAAGAGCTGGTCGTTCCAAAATT
TTTAGTTCTTAAGTTGCACGTAAAATTCTATTAAAATAAATTAAAATTTCTTTAAATGAA
AATAATTAATAAAAAAGATATATTAAATGATGAAACAACCAGAAAGTATTTGTAATCAAT
GAAGAGACTTGTTACAGTTTAATAGCTTATGTATCCTTCTGAAGATAAAGCTAAGATGAT
AAATTATGACAGTAAATATTTTTTTAATTTAAATAAAATAATATTAATCTATATTTTAAA
TAATTAGCAACAATGGAGGAGTTATTTTGA